Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_898846.2 | Gene: | A430033K04Rik / 243308 | MGIID: | 3583896 | Length: | 680 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 70/200 - (35%) |
---|---|---|---|
Similarity: | 98/200 - (49%) | Gaps: | 36/200 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 173 ERCRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSK 237
Fly 238 RAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHER 302
Fly 303 THTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVI 367
Fly 368 HHKNE 372 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 240..264 | CDD:290200 | 11/23 (48%) | ||
COG5048 | 249..>362 | CDD:227381 | 52/112 (46%) | ||
C2H2 Zn finger | 256..276 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 268..292 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 299..321 | CDD:290200 | 12/21 (57%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 340..362 | CDD:275368 | 8/21 (38%) | ||
A430033K04Rik | NP_898846.2 | KRAB | 16..75 | CDD:214630 | |
KRAB | 16..55 | CDD:279668 | |||
COG5048 | 261..670 | CDD:227381 | 70/199 (35%) | ||
C2H2 Zn finger | 429..449 | CDD:275370 | |||
zf-C2H2 | 455..477 | CDD:278523 | |||
C2H2 Zn finger | 457..477 | CDD:275368 | |||
zf-H2C2_2 | 470..492 | CDD:290200 | 3/5 (60%) | ||
C2H2 Zn finger | 485..505 | CDD:275368 | 6/30 (20%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 526..550 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 541..561 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 553..578 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 569..589 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 581..606 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 597..617 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 625..645 | CDD:275368 | 9/27 (33%) | ||
zf-H2C2_2 | 637..662 | CDD:290200 | 5/20 (25%) | ||
zf-C2H2 | 651..673 | CDD:278523 | |||
C2H2 Zn finger | 653..673 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |