DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and Zfp239

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001001792.1 Gene:Zfp239 / 22685 MGIID:1306812 Length:201 Species:Mus musculus


Alignment Length:137 Identity:64/137 - (46%)
Similarity:86/137 - (62%) Gaps:0/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 CEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFA 292
            |:.||..:::.::|.:|...|..||||||:.|.|.|:..|:|:.|.||||||||:.|:.|..||:
Mouse     8 CDKCGKGFTRSSSLLVHHSVHTGEKPFKCDRCGKGFSQSSKLHIHKRVHTGEKPYACEECGMSFS 72

  Fly   293 DRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHL 357
            .||:...|:|.||.|||:.|..|||.||.|:.|..|..|||||||:.|..|.|.||:...|..||
Mouse    73 QRSNLHIHQRVHTGERPYKCGECGKGFSQSSNLHIHRCTHTGEKPYQCYECGKGFSQSSDLRIHL 137

  Fly   358 GTMTHQQ 364
            ...|.::
Mouse   138 RVHTGEK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
zf-H2C2_2 240..264 CDD:290200 11/23 (48%)
COG5048 249..>362 CDD:227381 57/112 (51%)
C2H2 Zn finger 256..276 CDD:275368 8/19 (42%)
zf-H2C2_2 268..292 CDD:290200 13/23 (57%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 340..362 CDD:275368 8/21 (38%)
Zfp239NP_001001792.1 COG5048 <4..148 CDD:227381 64/137 (47%)
C2H2 Zn finger 8..28 CDD:275368 5/19 (26%)
C2H2 Zn finger 36..56 CDD:275368 8/19 (42%)
C2H2 Zn finger 64..84 CDD:275368 8/19 (42%)
C2H2 Zn finger 92..112 CDD:275368 9/19 (47%)
SFP1 <114..201 CDD:227516 13/31 (42%)
C2H2 Zn finger 120..140 CDD:275368 8/19 (42%)
C2H2 Zn finger 148..168 CDD:275368
C2H2 Zn finger 176..196 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.