Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022205.1 | Gene: | klf-3 / 191713 | WormBaseID: | WBGene00003480 | Length: | 315 | Species: | Caenorhabditis elegans |
Alignment Length: | 355 | Identity: | 85/355 - (23%) |
---|---|---|---|
Similarity: | 128/355 - (36%) | Gaps: | 128/355 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 VVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDDIGMENIMEEPLEDGVGETSQAYETST 149
Fly 150 VVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGRGRPRGASSGHPR---SFSEERPPV 211
Fly 212 Q-----------ASFKSSPEV-SSTNIMCEICGNIY-----SKR-----------AALNIHMR-- 246
Fly 247 -RHMAEKP-----------------FKCEI------------------CSKSFAGPSELNRHIRV 275
Fly 276 HTG-----EKPFL---CKY--CNRSFADRSSNIR-HERTHTNERPFTC--STCGKAFSYSNVLKN 327
Fly 328 HMLTHTGEKPFLCRVCNKTFSRKHQLDQHL 357 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 7/38 (18%) | ||
zf-H2C2_2 | 240..264 | CDD:290200 | 9/61 (15%) | ||
COG5048 | 249..>362 | CDD:227381 | 44/157 (28%) | ||
C2H2 Zn finger | 256..276 | CDD:275368 | 7/37 (19%) | ||
zf-H2C2_2 | 268..292 | CDD:290200 | 8/33 (24%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 8/22 (36%) | ||
zf-H2C2_2 | 299..321 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 340..362 | CDD:275368 | 6/18 (33%) | ||
klf-3 | NP_001022205.1 | C2H2 Zn finger | 235..254 | CDD:275368 | 6/19 (32%) |
C2H2 Zn finger | 262..284 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 276..301 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 6/18 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |