DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and ZNF596

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001035880.1 Gene:ZNF596 / 169270 HGNCID:27268 Length:504 Species:Homo sapiens


Alignment Length:382 Identity:108/382 - (28%)
Similarity:162/382 - (42%) Gaps:67/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TEDINSEAMAPLFDD--NDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVE----RLTSAHKF 70
            |:...|:....:|.|  :..|.:|:..|.:..||          .:..|:.::    |..|....
Human   136 TKHFVSKKFGKIFSDWLSFNQHKEIHTKCKSYGS----------HLFDYAFIQNSALRPHSVTHT 190

  Fly    71 REL---CQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDDIGMENIMEE 132
            ||:   |:...:||:.|......:...|.|.|| ........:...:|.........|     |:
Human   191 REITLECRVCGKTFSKNSNLRRHEMIHTGEKPH-GCHLCGKAFTHCSDLRKHERTHTG-----EK 249

  Fly   133 PLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKA-----KVRKTRMTKRGRGR 192
            |.  |.....:|:..|:   :|...:::   .|....|....|.||     .:||...|..| .:
Human   250 PY--GCHLCGKAFSKSS---NLRRHEMI---HTREKAQICHLCGKAFTHCSDLRKHERTHLG-DK 305

  Fly   193 PRGA------------SSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHM 245
            |.|.            ...|.|:.:.|:|                ..|.:||..:|..:.|..|.
Human   306 PYGCLLCGKAFSKCSYLRQHERTHNGEKP----------------YECHLCGKAFSHCSHLRQHE 354

  Fly   246 RRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPF 310
            |.|..|||..|.:|.|:|...|.|.||.|:||||||:.|..|.::|.:.|...|||||||.|:|:
Human   355 RSHNGEKPHGCHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTHTGEKPY 419

  Fly   311 TCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVI 367
            .|..|||||::|:||:.|..|||||||:.|.:|.|.|:|.:....|....|.::..:
Human   420 ECHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEKPYV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 15/77 (19%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 54/112 (48%)
C2H2 Zn finger 256..276 CDD:275368 9/19 (47%)
zf-H2C2_2 268..292 CDD:290200 12/23 (52%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 15/21 (71%)
C2H2 Zn finger 312..332 CDD:275368 10/19 (53%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)
ZNF596NP_001035880.1 KRAB 7..67 CDD:214630
KRAB 7..46 CDD:279668
C2H2 Zn finger 197..217 CDD:275368 4/19 (21%)
C2H2 Zn finger 225..245 CDD:275368 1/19 (5%)
C2H2 Zn finger 253..273 CDD:275368 3/25 (12%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
C2H2 Zn finger 309..329 CDD:275368 2/19 (11%)
zf-H2C2_2 321..346 CDD:290200 7/40 (18%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
COG5048 <361..502 CDD:227381 54/116 (47%)
C2H2 Zn finger 365..385 CDD:275368 9/19 (47%)
zf-H2C2_2 378..401 CDD:290200 12/22 (55%)
C2H2 Zn finger 393..413 CDD:275368 8/19 (42%)
zf-H2C2_2 405..430 CDD:290200 15/24 (63%)
C2H2 Zn finger 421..441 CDD:275368 10/19 (53%)
zf-H2C2_2 434..458 CDD:290200 13/23 (57%)
C2H2 Zn finger 449..469 CDD:275368 6/19 (32%)
zf-H2C2_2 461..485 CDD:290200 2/16 (13%)
C2H2 Zn finger 477..497 CDD:275368 108/382 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.