Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001307300.2 | Gene: | ZNF582 / 147948 | HGNCID: | 26421 | Length: | 517 | Species: | Homo sapiens |
Alignment Length: | 211 | Identity: | 71/211 - (33%) |
---|---|---|---|
Similarity: | 103/211 - (48%) | Gaps: | 43/211 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 CRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRA 239
Fly 240 ALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTH 304
Fly 305 TNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMT-------- 361
Fly 362 -------HQQTVIHHK 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 240..264 | CDD:290200 | 10/23 (43%) | ||
COG5048 | 249..>362 | CDD:227381 | 52/127 (41%) | ||
C2H2 Zn finger | 256..276 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 268..292 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 299..321 | CDD:290200 | 13/21 (62%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 340..362 | CDD:275368 | 8/36 (22%) | ||
ZNF582 | NP_001307300.2 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |