DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and ZNF684

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_689586.3 Gene:ZNF684 / 127396 HGNCID:28418 Length:378 Species:Homo sapiens


Alignment Length:395 Identity:98/395 - (24%)
Similarity:148/395 - (37%) Gaps:126/395 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VPLQNIPSMLCYSCVERLTSAHKFRELCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYE 111
            |.|:|..:::...|....|..                 ::|.|...||             ::.|
Human    36 VMLENYRNLISVGCPITKTKV-----------------ILKVEQGQEP-------------WMVE 70

  Fly   112 SANDFIDGVEDDIGMENIMEEPLEDGVGETSQA-----------------------YETSTVVDD 153
            .||......|.|.        ||.|..|:..::                       |..||.::.
Human    71 GANPHESSPESDY--------PLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYNMSTSLNP 127

  Fly   154 LDE------DDLLVPN----------STDSDYQPIERCRKAKVRKTRMTKR-------------- 188
            :.:      :..|.||          :.::.|:..| |.||..:|....:.              
Human   128 MRKKSYKSFEKCLPPNLDLLKYNRSYTVENAYECSE-CGKAFKKKFHFIRHEKNHTRKKPFECND 191

  Fly   189 -GRGRPRGAS-SGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHMRRHMAE 251
             |:...|.|. :.|.:..:.|||                .:|..||..:..:|.|.:|.|.|..|
Human   192 CGKAYSRKAHLATHQKIHNGERP----------------FVCNDCGKAFMHKAQLVVHQRLHTGE 240

  Fly   252 KPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCG 316
            ||::|..|.|:|...|..|:|::.||.||.|.||.|.::|...||..:|.|.||.|:|:.|..||
Human   241 KPYECSQCGKTFTWNSSFNQHVKSHTLEKSFECKECGKTFRYSSSLYKHSRFHTGEKPYQCIICG 305

  Fly   317 KAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQ----------------T 365
            |||..::||..|...||||||:.|..|.|.|.:|..|.:|..|.|.::                .
Human   306 KAFGNTSVLVTHQRIHTGEKPYSCIECGKAFIKKSHLLRHQITHTGEKPYECNRCGKAFSQKSNL 370

  Fly   366 VIHHK 370
            ::|.|
Human   371 IVHQK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 5/33 (15%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 50/112 (45%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..292 CDD:290200 10/23 (43%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 340..362 CDD:275368 8/21 (38%)
ZNF684NP_689586.3 KRAB 8..68 CDD:214630 9/61 (15%)
KRAB 8..47 CDD:279668 3/10 (30%)
C2H2 Zn finger 161..181 CDD:275368 5/20 (25%)
zf-H2C2_2 173..198 CDD:290200 1/24 (4%)
COG5048 <185..345 CDD:227381 63/175 (36%)
zf-C2H2 187..209 CDD:278523 4/21 (19%)
C2H2 Zn finger 189..209 CDD:275368 4/19 (21%)
zf-H2C2_2 201..224 CDD:290200 7/38 (18%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 230..253 CDD:290200 10/22 (45%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 285..308 CDD:290200 11/22 (50%)
C2H2 Zn finger 301..321 CDD:275368 9/19 (47%)
zf-H2C2_2 314..336 CDD:290200 11/21 (52%)
COG5048 325..>378 CDD:227381 13/51 (25%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 341..366 CDD:290200 4/24 (17%)
C2H2 Zn finger 357..377 CDD:275368 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.