Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002836.2 | Gene: | ZNF787 / 126208 | HGNCID: | 26998 | Length: | 382 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 73/225 - (32%) |
---|---|---|---|
Similarity: | 109/225 - (48%) | Gaps: | 39/225 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 PLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGRGRPRGAS 197
Fly 198 SGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKS 262
Fly 263 FAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKN 327
Fly 328 HMLTHTGEKPFLCRVCNKTFSRKHQLDQHL 357 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 240..264 | CDD:290200 | 9/23 (39%) | ||
COG5048 | 249..>362 | CDD:227381 | 46/109 (42%) | ||
C2H2 Zn finger | 256..276 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 268..292 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 299..321 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 340..362 | CDD:275368 | 7/18 (39%) | ||
ZNF787 | NP_001002836.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..65 | 18/85 (21%) | |
COG5048 | <67..200 | CDD:227381 | 54/137 (39%) | ||
C2H2 Zn finger | 68..88 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 96..116 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 124..144 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 152..172 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 180..200 | CDD:275368 | 7/18 (39%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | |||
C2H2 Zn finger | 319..339 | CDD:275368 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 357..382 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 137 | 1.000 | Inparanoid score | I4545 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |