DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and ZNF554

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001096121.1 Gene:ZNF554 / 115196 HGNCID:26629 Length:538 Species:Homo sapiens


Alignment Length:354 Identity:102/354 - (28%)
Similarity:157/354 - (44%) Gaps:89/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ERLTSAHKFRE---------LCQESER------------TFATNVV-------KAEMKSEPTDEV 98
            |:.|:.|.|.|         |.|.|.:            :.|::.|       .|:.:...::|.
Human   214 EKATAWHGFGENGNLSPALVLSQGSSKGNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNEC 278

  Fly    99 PHVVADNIEYIYESANDFI---DGVEDDIGME-------NIMEEPLEDGVGETSQAYETSTVVD- 152
            .:.:..|..:|......|:   :|...:.||.       |..|:|.|        .::...|.: 
Human   279 GNAIRQNSHFIQHGGKMFVYLENGQSLNHGMALTIHNKINTAEKPFE--------CHQCGKVFNR 335

  Fly   153 --DLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASF 215
              .|.|...:  ::.:..|: .:.|.:|....:.:|:            |.|:.:.|:|      
Human   336 RHSLSEHQRI--HTGEKPYE-CQECGRAFTHSSTLTR------------HLRTHTGEKP------ 379

  Fly   216 KSSPEVSSTNIMCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEK 280
                      ..|..||..:::.::|..|.|.|..|||:|||.|.|||...|.|..|.|.|||||
Human   380 ----------YGCGECGKAFNRISSLTQHQRIHTGEKPYKCEDCGKSFCQSSYLILHKRTHTGEK 434

  Fly   281 PFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNK 345
            |:.|..|.::|:||||..:||||||.|.|:.|..||:|||..:.|..|..|||||||:.|:.|.|
Human   435 PYECSECGKAFSDRSSLNQHERTHTGENPYECKQCGRAFSQRSSLVRHERTHTGEKPYRCQECGK 499

  Fly   346 TFSRKHQLDQHLGTMTHQQTVIHHKNERT 374
            .||:...|      :|||:|   |.:::|
Human   500 AFSQSSSL------VTHQKT---HSSQKT 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 8/39 (21%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 13/23 (57%)
COG5048 249..>362 CDD:227381 56/112 (50%)
C2H2 Zn finger 256..276 CDD:275368 10/19 (53%)
zf-H2C2_2 268..292 CDD:290200 11/23 (48%)
C2H2 Zn finger 284..304 CDD:275368 10/19 (53%)
zf-H2C2_2 299..321 CDD:290200 13/21 (62%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)
ZNF554NP_001096121.1 KRAB 44..84 CDD:307490
COG5048 <225..417 CDD:227381 43/230 (19%)
C2H2 Zn finger 276..291 CDD:275368 3/14 (21%)
C2H2 Zn finger 293..318 CDD:275368 4/24 (17%)
zf-C2H2 324..346 CDD:306579 4/31 (13%)
C2H2 Zn finger 326..346 CDD:275368 3/21 (14%)
COG5048 <350..532 CDD:227381 77/208 (37%)
C2H2 Zn finger 354..374 CDD:275368 5/31 (16%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
C2H2 Zn finger 410..430 CDD:275368 10/19 (53%)
C2H2 Zn finger 438..458 CDD:275368 10/19 (53%)
C2H2 Zn finger 466..486 CDD:275368 8/19 (42%)
C2H2 Zn finger 494..514 CDD:275368 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.