Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_008758162.1 | Gene: | LOC103691238 / 103691238 | RGDID: | 9074604 | Length: | 337 | Species: | Rattus norvegicus |
Alignment Length: | 260 | Identity: | 78/260 - (30%) |
---|---|---|---|
Similarity: | 114/260 - (43%) | Gaps: | 58/260 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 131 EEPLED-------GVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRM--- 185
Fly 186 ----TKRGRGRP-----------RGAS-SGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNI 234
Fly 235 YSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIR 299
Fly 300 HERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQ 364
Fly 365 364 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 240..264 | CDD:290200 | 8/23 (35%) | ||
COG5048 | 249..>362 | CDD:227381 | 48/112 (43%) | ||
C2H2 Zn finger | 256..276 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 268..292 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 299..321 | CDD:290200 | 12/21 (57%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 340..362 | CDD:275368 | 6/21 (29%) | ||
LOC103691238 | XP_008758162.1 | C2H2 Zn finger | 90..110 | CDD:275368 | 2/19 (11%) |
COG5048 | <111..270 | CDD:227381 | 63/174 (36%) | ||
C2H2 Zn finger | 118..138 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 146..166 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 174..194 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 202..222 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 230..250 | CDD:275368 | 9/19 (47%) | ||
COG5048 | 254..>314 | CDD:227381 | 9/29 (31%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | |||
C2H2 Zn finger | 314..334 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 139 | 1.000 | Inparanoid score | I4420 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |