DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and si:ch73-109d9.3

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_005160142.1 Gene:si:ch73-109d9.3 / 101883524 ZFINID:ZDB-GENE-141212-331 Length:470 Species:Danio rerio


Alignment Length:172 Identity:53/172 - (30%)
Similarity:73/172 - (42%) Gaps:26/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PNSTDSDYQPIERCRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNI 226
            ||:..||:..::..|.....|....   |..|.||..   |||:...|.     :|.|.|.:..:
Zfish   318 PNAAMSDHGAVDLNRSLPAPKLSQV---RQYPEGAGE---RSFNTMNPG-----RSLPPVVNMRV 371

  Fly   227 MCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSF 291
            ..:          |.||     .|:....|..|.|.|:....|..|.::|||::.|.|..|.|||
Zfish   372 QVD----------ARNI-----SAKTTHNCSQCGKGFSHLCHLRAHQQIHTGDRQFCCTICGRSF 421

  Fly   292 ADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHT 333
            ...|:...|.|.||.|||:.|:.|||.|:....||.|...|:
Zfish   422 TKLSNLKAHRRVHTGERPYICADCGKRFTQKCNLKRHQRIHS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 3/19 (16%)
zf-H2C2_2 240..264 CDD:290200 7/23 (30%)
COG5048 249..>362 CDD:227381 33/85 (39%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-H2C2_2 268..292 CDD:290200 10/23 (43%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 4/9 (44%)
C2H2 Zn finger 340..362 CDD:275368
si:ch73-109d9.3XP_005160142.1 RPW8 <21..>72 CDD:283345
zf-C2H2 384..406 CDD:278523 6/21 (29%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
zf-H2C2_2 398..422 CDD:290200 10/23 (43%)
C2H2 Zn finger 414..434 CDD:275368 8/19 (42%)
zf-H2C2_2 426..451 CDD:290200 12/24 (50%)
C2H2 Zn finger 442..462 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.