DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and bcl6ab

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_005171194.1 Gene:bcl6ab / 100001936 ZFINID:ZDB-GENE-030131-7523 Length:566 Species:Danio rerio


Alignment Length:363 Identity:97/363 - (26%)
Similarity:143/363 - (39%) Gaps:61/363 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PLQNIPSMLC-----YSCVERLTSAHKFRELCQE---SERTFATNVVKAEMKSEPTDEVPHVVA- 103
            ||..||....     :|..|..|||........|   .||. ..:|:....::|...:.|.:.: 
Zfish   202 PLWQIPKTTVIAHQQHSLPESGTSARTITNAAVEDGDKERN-RPSVLFRSARAEGNRKAPLLSSE 265

  Fly   104 -DNIEYIYESANDFIDGVEDDIGMENIMEEPLEDGVGETSQAYETSTV----VDDLDEDDLLVPN 163
             :|||..:..      |.|..:..:.....|.|........|...|::    |.:..:...:|.|
Zfish   266 VENIEACHTG------GPESPLRSDCQPNSPAESSGCSRRPASPPSSITYAKVHNWKKYKFIVLN 324

  Fly   164 STD-SDYQPIERCRKA-------KVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPE 220
            ||| |...|.....::       |.:..|.|.....:....||.| .:|:||     :|..|:..
Zfish   325 STDNSSLTPPHTVSESTNQNAEHKGQDNRSTDECIKKEEHGSSVH-NTFTEE-----SSMGSTNS 383

  Fly   221 VSSTNIMCEIC------------GNIYS----------KRAALNIHMRRHMAEKPFKCEICSKSF 263
            .....:.|..|            |..|.          |...|:.|...|..|||::|.:|...|
Zfish   384 AERERVYCNECESEAEKPQWLQDGKPYKCDRCQAMFHYKGNPLSSHKSVHTGEKPYRCNVCGAQF 448

  Fly   264 AGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNH 328
            ..|:.|..|.|:|:||||:.|:.|:..|...:....|...||.|:|:.|..||..|.:...||:|
Zfish   449 NRPANLKTHSRIHSGEKPYKCETCSSRFVQVAHLRAHVLIHTGEKPYPCDICGTRFRHLQTLKSH 513

  Fly   329 MLTHTGEKPFLCRVCNKTFSRKHQLDQHL----GTMTH 362
            :..||||||:.|..|:..|..|.||..||    |.:|:
Zfish   514 LRIHTGEKPYHCENCDLRFRHKSQLRLHLRQKHGAITN 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 12/40 (30%)
C2H2 Zn finger 228..248 CDD:275368 7/41 (17%)
zf-H2C2_2 240..264 CDD:290200 8/23 (35%)
COG5048 249..>362 CDD:227381 45/116 (39%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..292 CDD:290200 10/23 (43%)
C2H2 Zn finger 284..304 CDD:275368 4/19 (21%)
zf-H2C2_2 299..321 CDD:290200 9/21 (43%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 340..362 CDD:275368 9/25 (36%)
bcl6abXP_005171194.1 BTB 22..126 CDD:279045
BTB 33..128 CDD:197585
C2H2 Zn finger 412..433 CDD:275368 3/20 (15%)
zf-H2C2_2 426..450 CDD:290200 9/23 (39%)
C2H2 Zn finger 441..461 CDD:275368 7/19 (37%)
zf-H2C2_2 453..478 CDD:290200 11/24 (46%)
C2H2 Zn finger 469..489 CDD:275368 4/19 (21%)
zf-H2C2_2 481..506 CDD:290200 9/24 (38%)
C2H2 Zn finger 497..517 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 12/23 (52%)
C2H2 Zn finger 525..543 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.