DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and ZNF559

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001189335.1 Gene:ZNF559 / 84527 HGNCID:28197 Length:602 Species:Homo sapiens


Alignment Length:371 Identity:95/371 - (25%)
Similarity:142/371 - (38%) Gaps:81/371 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRTCRKKGTQSTLQSLFESNAHKLLISYAGTSVKPDDG--LPDQICTVCLMQLEEVDRFLSACKQ 72
            |..|.|...:.::.:|     ||          |.|.|  ||:  |..|.....:  .....||:
Human   185 CNQCEKAFRKPSIFTL-----HK----------KTDIGEELPN--CNQCETAFSQ--HLHLVCKK 230

  Fly    73 SDAHLRSLVRQTLSSASAFETLEDKDQLEQKKRARK-QNISGRLIEENPINFKTQENALETTKDD 136
            :..:|..:.::|.:....::..:.:..|......|: ..|.|   .|.|.   |.:..:||    
Human   231 TSQNLHLVCKKTHTQEKPYKCSDCEKGLPSSSHLRECVRIYG---GERPY---THKEYVET---- 285

  Fly   137 EILPINKFSSDFVFDLNVNAENEKDIHQ-----EDYTISDMDLDREISDQNYSETYSQESSAATD 196
                   ||......:::..::.:..::     :.:|                     |||..|.
Human   286 -------FSHSTALFVHMQTQDGEKFYECKACGKPFT---------------------ESSYLTQ 322

  Fly   197 SIQETSEDYHNLEPSADYVIDLGVACEPD------------KYRCKICSNTYRCLSQLNAHSQVH 249
            .::..|    .:.|..........|..||            .|.|..|...:.|.|:||.|.:||
Human   323 HLRTHS----RVLPIEHKKFGKAFAFSPDLAKHIRLRTRGKHYVCNECGKEFTCFSKLNIHIRVH 383

  Fly   250 RKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRRFADNSTHRKHERLHTNERPYACN 314
            ..||.::|..|.|.|..:..|..|.|||||||||:|..|.:.||::|....|.|.||.|:||.|.
Human   384 TGEKPYECNKCGKAFTDSSGLIKHRRTHTGEKPYECKECGKAFANSSHLTVHMRTHTGEKPYQCK 448

  Fly   315 ICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAHEKS 360
            .|||.|..|||..:|...|...|.:.|..|.|.|.....|..|.:|
Human   449 ECGKAFINSSSFKSHMQTHPGVKPYDCQQCGKAFIRSSFLIRHLRS 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 16/70 (23%)
C2H2 Zn finger 229..249 CDD:275368 7/19 (37%)
zf-C2H2 255..277 CDD:278523 7/21 (33%)
C2H2 Zn finger 257..277 CDD:275368 7/19 (37%)
zf-H2C2_2 269..293 CDD:290200 13/23 (57%)
C2H2 Zn finger 285..305 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 11/21 (52%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)
ZNF559NP_001189335.1 KRAB 78..>118 CDD:214630
KRAB 78..117 CDD:279668
C2H2 Zn finger 158..177 CDD:275368
C2H2 Zn finger 185..240 CDD:275368 16/73 (22%)
COG5048 212..601 CDD:227381 84/329 (26%)
C2H2 Zn finger 213..243 CDD:275368 5/31 (16%)
C2H2 Zn finger 251..299 CDD:275368 11/64 (17%)
C2H2 Zn finger 307..327 CDD:275368 5/40 (13%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-H2C2_2 376..399 CDD:290200 10/22 (45%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 404..428 CDD:290200 14/23 (61%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
zf-H2C2_2 431..454 CDD:290200 11/22 (50%)
zf-C2H2 445..467 CDD:278523 10/21 (48%)
C2H2 Zn finger 447..467 CDD:275368 9/19 (47%)
C2H2 Zn finger 475..495 CDD:275368 7/20 (35%)
zf-H2C2_2 488..512 CDD:290200 3/7 (43%)
C2H2 Zn finger 503..523 CDD:275368
zf-H2C2_2 515..539 CDD:290200
C2H2 Zn finger 531..551 CDD:275368
zf-H2C2_2 544..568 CDD:290200
C2H2 Zn finger 559..579 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.