DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and IDD16

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001321791.1 Gene:IDD16 / 839108 AraportID:AT1G25250 Length:385 Species:Arabidopsis thaliana


Alignment Length:150 Identity:40/150 - (26%)
Similarity:63/150 - (42%) Gaps:36/150 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 EPSADYVIDLG--VACEPDKYRCKICSNTYRCLSQLNAHSQVH--------RKEKDHQCE----V 259
            :|.|: |:.|.  ...|.|:|.|:||:..::....|..|.:.|        |.:||.:..    |
plant    43 DPDAE-VVSLSPRTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRDKKDEEVRKRVYV 106

  Fly   260 CQKTFRAAC-------------NLKTHM-RTHTGEKPYQCCYCSRRFADNSTHRKHERLHT-NER 309
            |.:   ..|             .:|.|. |.|:..|.:.|..||:.:|..|.::.|  |.| ..|
plant   107 CPE---PTCLHHDPCHALGDLVGIKKHFRRKHSVHKQWVCERCSKGYAVQSDYKAH--LKTCGSR 166

  Fly   310 PYACNICGKTFSLSSSRNAH 329
            .::|: ||:.||...|...|
plant   167 GHSCD-CGRVFSRVESFIEH 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
zf-C2H2 255..277 CDD:278523 6/39 (15%)
C2H2 Zn finger 257..277 CDD:275368 6/37 (16%)
zf-H2C2_2 269..293 CDD:290200 8/24 (33%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
zf-H2C2_2 299..321 CDD:290200 7/22 (32%)
C2H2 Zn finger 313..333 CDD:275368 6/16 (38%)
C2H2 Zn finger 341..359 CDD:275368
IDD16NP_001321791.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2553
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.