DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6808 and ZNF669

DIOPT Version :9

Sequence 1:	NP_001247055.1	Gene:	CG6808 / 41394	FlyBaseID:	FBgn0037921	Length:	375	Species:	Drosophila melanogaster
Sequence 2:	NP_079080.2	Gene:	ZNF669 / 79862	HGNCID:	25736	Length:	464	Species:	Homo sapiens

Alignment Length:	133	Identity:	55/133 - (41%)
Similarity:	76/133 - (57%)	Gaps:	0/133 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   227 YRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRR 291
            |:||.|...:........|.:.|..||.::|:.|.||||.:|:.|||.||||||:||:|..|.:.
Human   278 YKCKQCGKAFTVSGSCLIHERTHTGEKPYECKECGKTFRFSCSFKTHERTHTGERPYKCTKCDKA 342

  Fly   292 FADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTA 356
            |:.:::.|.|..:||.||||.|..|||.||..||...|...|:.||.::|..|.:.|.....|..
Human   343 FSCSTSLRYHGSIHTGERPYECKQCGKAFSRLSSLCNHRSTHTGEKPYECKQCDQAFSRLSSLHL 407

  Fly   357 HEK 359
            ||:
Human   408 HER 410

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6808	NP_001247055.1	zf-AD	9..79	CDD:214871
		C2H2 Zn finger	229..249	CDD:275368	4/19 (21%)
		zf-C2H2	255..277	CDD:278523	11/21 (52%)
		C2H2 Zn finger	257..277	CDD:275368	11/19 (58%)
		zf-H2C2_2	269..293	CDD:290200	13/23 (57%)
		C2H2 Zn finger	285..305	CDD:275368	5/19 (26%)
		zf-H2C2_2	299..321	CDD:290200	12/21 (57%)
		C2H2 Zn finger	313..333	CDD:275368	9/19 (47%)
		C2H2 Zn finger	341..359	CDD:275368	5/17 (29%)
ZNF669	NP_079080.2	KRAB	90..>132	CDD:214630
		KRAB	90..129	CDD:279668
		C2H2 Zn finger	167..183	CDD:275368
		COG5048	<178..436	CDD:227381	55/133 (41%)
		C2H2 Zn finger	191..211	CDD:275368
		C2H2 Zn finger	252..272	CDD:275368
		zf-H2C2_2	264..288	CDD:290200	4/9 (44%)
		C2H2 Zn finger	280..300	CDD:275368	4/19 (21%)
		zf-H2C2_2	296..315	CDD:290200	7/18 (39%)
		C2H2 Zn finger	308..328	CDD:275368	11/19 (58%)
		zf-H2C2_2	320..345	CDD:290200	14/24 (58%)
		C2H2 Zn finger	336..356	CDD:275368	5/19 (26%)
		zf-H2C2_2	348..373	CDD:290200	13/24 (54%)
		C2H2 Zn finger	364..384	CDD:275368	9/19 (47%)
		zf-H2C2_2	379..401	CDD:290200	7/21 (33%)
		C2H2 Zn finger	392..412	CDD:275368	6/19 (32%)
		zf-H2C2_2	408..429	CDD:290200	2/3 (67%)
		C2H2 Zn finger	420..440	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910