DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and ZNF22

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_008894.2 Gene:ZNF22 / 7570 HGNCID:13012 Length:224 Species:Homo sapiens


Alignment Length:136 Identity:55/136 - (40%)
Similarity:75/136 - (55%) Gaps:1/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 DK-YRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYC 288
            || |:|..|..::...|.|..|.::|..:|.|:|..|.|:|..:.||..|.|.|||||||:|..|
Human    52 DKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDEC 116

  Fly   289 SRRFADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQ 353
            ...|..:|...:|:|:||.|:||.|:.||:.||.||....|...|:.||.::|..|.|.|.....
Human   117 GESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSH 181

  Fly   354 LTAHEK 359
            |..|.|
Human   182 LRQHMK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
zf-C2H2 255..277 CDD:278523 9/21 (43%)
C2H2 Zn finger 257..277 CDD:275368 8/19 (42%)
zf-H2C2_2 269..293 CDD:290200 13/23 (57%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
zf-H2C2_2 299..321 CDD:290200 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)
ZNF22NP_008894.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
COG5048 <41..194 CDD:227381 55/136 (40%)
C2H2 Zn finger 57..77 CDD:275368 5/19 (26%)
C2H2 Zn finger 85..105 CDD:275368 8/19 (42%)
C2H2 Zn finger 113..133 CDD:275368 6/19 (32%)
C2H2 Zn finger 141..161 CDD:275368 8/19 (42%)
C2H2 Zn finger 169..189 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.