DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and ZNF19

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_008892.2 Gene:ZNF19 / 7567 HGNCID:12981 Length:458 Species:Homo sapiens


Alignment Length:131 Identity:49/131 - (37%)
Similarity:71/131 - (54%) Gaps:0/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 YRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRR 291
            |.|..|.|::...|:...|.::|..||.::|..|.|.|.....|..|.:.|||||||:|..|.:.
Human   245 YYCTECGNSFTSSSEFVIHQRIHTGEKPYECNECGKAFVGNSPLLRHQKIHTGEKPYECNECGKS 309

  Fly   292 FADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTA 356
            |...|...:|:|:||.|:||:|.:||:.|:..:....|..:||.||...|:.|.|.|..:.||..
Human   310 FGRTSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRIHSEEKPFDCVDCGKAFSAQEQLKR 374

  Fly   357 H 357
            |
Human   375 H 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
zf-C2H2 255..277 CDD:278523 6/21 (29%)
C2H2 Zn finger 257..277 CDD:275368 6/19 (32%)
zf-H2C2_2 269..293 CDD:290200 11/23 (48%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
zf-H2C2_2 299..321 CDD:290200 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 5/19 (26%)
C2H2 Zn finger 341..359 CDD:275368 7/17 (41%)
ZNF19NP_008892.2 KRAB 14..73 CDD:214630
KRAB 14..53 CDD:279668
COG5048 <96..426 CDD:227381 49/131 (37%)
C2H2 Zn finger 163..183 CDD:275368
zf-H2C2_2 178..199 CDD:290200
C2H2 Zn finger 191..211 CDD:275368
zf-H2C2_2 203..227 CDD:290200
C2H2 Zn finger 219..239 CDD:275368
zf-H2C2_2 231..256 CDD:290200 4/10 (40%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
zf-H2C2_2 263..283 CDD:290200 7/19 (37%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-H2C2_2 288..312 CDD:290200 12/23 (52%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
zf-H2C2_2 315..339 CDD:290200 10/23 (43%)
C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
zf-H2C2_2 344..367 CDD:290200 8/22 (36%)
C2H2 Zn finger 359..379 CDD:275368 7/17 (41%)
zf-H2C2_2 372..393 CDD:290200 2/4 (50%)
C2H2 Zn finger 387..407 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.