DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and ZNF691

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001229668.1 Gene:ZNF691 / 51058 HGNCID:28028 Length:315 Species:Homo sapiens


Alignment Length:183 Identity:59/183 - (32%)
Similarity:92/183 - (50%) Gaps:7/183 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 ETYSQESSAATDSIQETSEDYH-------NLEPSADYVIDLGVACEPDKYRCKICSNTYRCLSQL 242
            :|::..|:..|.....|.|..:       :...|::.:....:..|...|:|..|..::|..|.|
Human   122 KTFNNTSNLRTHQRIHTGEKPYKCSECGKSFSRSSNRIRHERIHLEEKHYKCPKCQESFRRRSDL 186

  Fly   243 NAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRRFADNSTHRKHERLHTN 307
            ..|.|.|..::.::|::|.|:|..:..|..|.|||....||.||.|.:.|:::|:...|.|.||.
Human   187 TTHQQDHLGKRPYRCDICGKSFSQSATLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTG 251

  Fly   308 ERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAHEKS 360
            ||||.|..||:|||..|:..||...|..||.::|.:|.|.|.....|..|:|:
Human   252 ERPYECTECGRTFSDISNFGAHQRTHRGEKPYRCTVCGKHFSRSSNLIRHQKT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871
C2H2 Zn finger 229..249 CDD:275368 7/19 (37%)
zf-C2H2 255..277 CDD:278523 7/21 (33%)
C2H2 Zn finger 257..277 CDD:275368 7/19 (37%)
zf-H2C2_2 269..293 CDD:290200 10/23 (43%)
C2H2 Zn finger 285..305 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)
ZNF691NP_001229668.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
COG5048 <108..266 CDD:227381 45/143 (31%)
C2H2 Zn finger 117..137 CDD:275368 3/14 (21%)
C2H2 Zn finger 145..165 CDD:275368 1/19 (5%)
C2H2 Zn finger 173..193 CDD:275368 7/19 (37%)
C2H2 Zn finger 201..221 CDD:275368 7/19 (37%)
C2H2 Zn finger 229..249 CDD:275368 7/19 (37%)
C2H2 Zn finger 257..277 CDD:275368 9/19 (47%)
zf-C2H2 283..305 CDD:306579 7/22 (32%)
C2H2 Zn finger 285..305 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3304
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.