DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and CG1792

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:382 Identity:90/382 - (23%)
Similarity:145/382 - (37%) Gaps:82/382 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRTCRKKGTQSTLQSLFES-NA---HKL-----LISYAGTSVKPDDGLPDQICTVCLMQLEEVDR 65
            ||||......||..:|||. |:   |::     |....|    |.:.||..||:.|.:.|:....
  Fly     6 CRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGG----PGNELPPFICSPCELDLQTAIA 66

  Fly    66 FLSACKQSDAHLRSLVRQTLSSASAFETLEDKDQLEQKKRARKQNISGRLIEENPINFKTQENAL 130
            |           |..|.:|.      :||::...|.          :..|||...:..:.:....
  Fly    67 F-----------RERVIRTQ------KTLQESPNLG----------NAELIESFAVGVEKEIQYA 104

  Fly   131 ETTKDDEILPINKFSSDFVFDLNVNAENEKDIHQEDYTISDMDLDREISDQN--------YSETY 187
            |...:.|::                     |:..|::.:.:.:...||.:||        ..|..
  Fly   105 EEVTEIEVI---------------------DLLPEEHLLEETEEPYEICEQNEQPQVKVPAQEKK 148

  Fly   188 SQESSAAT----------DSIQETSEDYHNLEPSADYVIDLGVACEPDKYRCKICSNTYRCLSQL 242
            .:.|:..|          |:.|.|...:..|  :.|.|:.|..........|:.|...:.|.|..
  Fly   149 LRRSTKTTPTVFTSVKFADNSQATRTQWSRL--TEDEVVALKRERRKRDCICEQCGRHFTCPSNF 211

  Fly   243 NAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRRFADNSTHRKHERL-HT 306
            ..|...|...|...|:.|.:.|..|..|:.|...|.|...:||.||...:::.|...:|||: ||
  Fly   212 KLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEATYSNASGRIQHERMRHT 276

  Fly   307 NERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAHEKSLAH 363
            |.:|:.|..|.|:|::|.....|...|:..::..|..|:..|..:..||:|.:|..|
  Fly   277 NVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 21/77 (27%)
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
zf-C2H2 255..277 CDD:278523 6/21 (29%)
C2H2 Zn finger 257..277 CDD:275368 6/19 (32%)
zf-H2C2_2 269..293 CDD:290200 8/23 (35%)
C2H2 Zn finger 285..305 CDD:275368 7/20 (35%)
zf-H2C2_2 299..321 CDD:290200 10/22 (45%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 26/94 (28%)
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 296..320 CDD:290200 5/23 (22%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.