DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and ouib

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:369 Identity:96/369 - (26%)
Similarity:148/369 - (40%) Gaps:84/369 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MCRTC-RKKGTQSTLQSLFESNAHKLLISYAGTSVKPDDGLPDQICTVCLMQLEEVDRFLSACKQ 72
            :||.| |:|..:.:| :||:....|.|...            ..|..:.|:.|::|..|:..|.|
  Fly     5 VCRVCGRQKICEKSL-NLFDLVNRKYLKHL------------HMISGLRLVDLDDVPGFMCLCCQ 56

  Fly    73 SDAHLRSLVRQTLSSASAFETLEDKDQLEQKKRARKQNISGRLIEENPINFKTQENALETTKDDE 137
            ::          |.||.||..|                           ..|||...| |.:|| 
  Fly    57 AE----------LRSALAFRKL---------------------------CIKTQTKWL-TIEDD- 82

  Fly   138 ILPINKFSSDFVFDLNVNAENEKDIHQEDYTISDMDLDRE-----------ISDQNYSETYSQES 191
                   ||....|.|.|:|    :..|....||....:|           |.::...:|.::::
  Fly    83 -------SSSGDEDTNDNSE----LESEKCAFSDFGKKKEGELVEETFQVLIEEEPMDKTLNRDA 136

  Fly   192 SA--ATDSIQETSEDYHNLEPSADYVIDLGVACEPDKYRCKICSNTYRCLSQLNAHSQVHRKEKD 254
            .|  ..|.|.|      ...|| ..:|.:....:...|.|::|............|.:.||.|:.
  Fly   137 KAQLREDGIDE------KCVPS-QKIIKVSTKLDDQIYICELCGTHATSKPTFQRHMRKHRGERP 194

  Fly   255 HQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRRFADNSTHRKHERLHTNERPYACNICGKT 319
            ..|:.|...|.:|..|:.|.|.||||:|:.|.:|.:|:........|||.|||:|||.|..|||.
  Fly   195 FGCKDCDARFLSAGELRAHHRVHTGEQPFACRFCEKRYVSYMGRLIHERTHTNDRPYVCEECGKK 259

  Fly   320 FSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAHEKSLAH 363
            |:.:.....|..:|:.|::.:|.:|.:.|:.|..|..|.:|:.|
  Fly   260 FTTAYVLKNHMVIHTGERNFRCDICDRSFQRKAHLVTHTRSMMH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 17/70 (24%)
C2H2 Zn finger 229..249 CDD:275368 3/19 (16%)
zf-C2H2 255..277 CDD:278523 7/21 (33%)
C2H2 Zn finger 257..277 CDD:275368 7/19 (37%)
zf-H2C2_2 269..293 CDD:290200 11/23 (48%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
zf-H2C2_2 299..321 CDD:290200 13/21 (62%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871 27/123 (22%)
COG5048 <158..300 CDD:227381 45/141 (32%)
C2H2 Zn finger 169..189 CDD:275368 3/19 (16%)
C2H2 Zn finger 197..217 CDD:275368 7/19 (37%)
zf-H2C2_2 209..234 CDD:290200 11/24 (46%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
zf-H2C2_2 241..262 CDD:290200 14/20 (70%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 5/21 (24%)
C2H2 Zn finger 281..299 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.