DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and Phs

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_648789.3 Gene:Phs / 39697 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster


Alignment Length:405 Identity:101/405 - (24%)
Similarity:161/405 - (39%) Gaps:100/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKKGTQSTLQSLFESNA-------------------------HKLLISYAGTSVKPDDGLPDQIC 53
            :|.||||..:|  |:|.                         .:|.|..||.:....|...:|  
  Fly   425 KKDGTQSAQKS--ETNPKHLENAETNSKDNTESVALKETIHDKQLTIDEAGKAGTQKDDNSNQ-- 485

  Fly    54 TVCLMQLEEVDRFLSACKQSDAHLRSLVRQTLSSASAFETLEDKDQLEQ-------KKRARKQNI 111
                .||::.:......|..|.     |.|.:...||    :|..|:.:       :||.||:..
  Fly   486 ----KQLDKSEANAGKSKMVDQ-----VHQQMPVESA----KDHQQMTEEPTNSTKRKRGRKERK 537

  Fly   112 SGRLIEENPINFKTQENALETTKDDEILPINKFSS-----DFVFDLNVNAENEKDIHQEDYTISD 171
            |     ..|:.....:..:   |::..||..:...     |:|.::       ||..::|..:.:
  Fly   538 S-----PTPVLIPLGDKEI---KEEPELPERRMRKSRQHVDYVVEI-------KDEEEDDDEVEE 587

  Fly   172 MDLDREISDQNYSETYSQESSAATDSI----QETSED-YHNLEPSADYVIDLGVACEPDKYRCKI 231
            .::     |.:.|.|.|..:|:..:|.    :|:||: .||           |:.   ..:.|..
  Fly   588 AEV-----DDDSSATISPHNSSTDESFTSIKRESSEESQHN-----------GIG---GIHTCNF 633

  Fly   232 CSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRRFA--- 293
            |..|::..|::..|.::|..||.:.|..|.:.||....|..|...|..||.|:|..||...|   
  Fly   634 CGKTFKRFSRMQDHLRLHTGEKPYVCGQCGRAFRLKMRLVEHQLRHRAEKAYKCDICSMPLATKQ 698

  Fly   294 DNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAHE 358
            |.|.|.:|   |.|:|.|.|:.|.|.|..||..:.|..:|:.||.:.|.:|.|.||.:..|..|.
  Fly   699 DLSLHMRH---HKNDRRYKCDKCNKGFVRSSDLSIHVRIHTGEKPYSCDLCGKAFRARQNLVVHR 760

  Fly   359 KS-LAHRLIAKEYSD 372
            :: |..:.|..|..|
  Fly   761 RTHLGDKPIQCELCD 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 18/89 (20%)
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
zf-C2H2 255..277 CDD:278523 6/21 (29%)
C2H2 Zn finger 257..277 CDD:275368 6/19 (32%)
zf-H2C2_2 269..293 CDD:290200 9/23 (39%)
C2H2 Zn finger 285..305 CDD:275368 8/22 (36%)
zf-H2C2_2 299..321 CDD:290200 8/21 (38%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
C2H2 Zn finger 341..359 CDD:275368 7/17 (41%)
PhsNP_648789.3 COG5048 <594..787 CDD:227381 62/199 (31%)
C2H2 Zn finger 631..651 CDD:275368 5/19 (26%)
zf-H2C2_2 644..666 CDD:290200 6/21 (29%)
zf-H2C2_2 699..724 CDD:290200 12/27 (44%)
zf-C2H2 713..735 CDD:278523 8/21 (38%)
C2H2 Zn finger 715..735 CDD:275368 7/19 (37%)
zf-H2C2_2 727..750 CDD:290200 7/22 (32%)
C2H2 Zn finger 743..763 CDD:275368 7/19 (37%)
zf-H2C2_2 755..780 CDD:290200 6/21 (29%)
C2H2 Zn finger 771..791 CDD:275368 2/5 (40%)
zf-H2C2_2 783..808 CDD:290200
C2H2 Zn finger 799..816 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3304
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.