DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6808 and klu

DIOPT Version :9

Sequence 1:	NP_001247055.1	Gene:	CG6808 / 41394	FlyBaseID:	FBgn0037921	Length:	375	Species:	Drosophila melanogaster
Sequence 2:	NP_001261690.1	Gene:	klu / 39228	FlyBaseID:	FBgn0013469	Length:	818	Species:	Drosophila melanogaster

Alignment Length:	112	Identity:	36/112 - (32%)
Similarity:	50/112 - (44%)	Gaps:	8/112 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   257 CEVCQKTFRAACNLKTHMRT-HTGEKP-------YQCCYCSRRFADNSTHRKHERLHTNERPYAC 313
            |..|.:.|.....|..||.: |....|       |.|..|.|.||.:....:|.||||..:||.|
  Fly   592 CPTCGQMFSLHDRLAKHMASRHKSRNPANDIAKAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTC 656

  Fly   314 NICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAHEKS 360
            .:||:.||.|...:.|...|:.||.:||..|......:..:|.|.::
  Fly   657 KVCGQVFSRSDHLSTHQRTHTGEKPYKCPQCPYAACRRDMITRHMRT 703

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6808	NP_001247055.1	zf-AD	9..79	CDD:214871
		C2H2 Zn finger	229..249	CDD:275368
		zf-C2H2	255..277	CDD:278523	6/20 (30%)
		C2H2 Zn finger	257..277	CDD:275368	6/20 (30%)
		zf-H2C2_2	269..293	CDD:290200	9/31 (29%)
		C2H2 Zn finger	285..305	CDD:275368	7/19 (37%)
		zf-H2C2_2	299..321	CDD:290200	10/21 (48%)
		C2H2 Zn finger	313..333	CDD:275368	7/19 (37%)
		C2H2 Zn finger	341..359	CDD:275368	4/17 (24%)
klu	NP_001261690.1	FYDLN_acid	<182..248	CDD:302856
		C2H2 Zn finger	592..613	CDD:275368	6/20 (30%)
		COG5048	607..>687	CDD:227381	29/79 (37%)
		zf-C2H2	626..648	CDD:278523	8/21 (38%)
		C2H2 Zn finger	628..648	CDD:275368	7/19 (37%)
		zf-H2C2_2	640..665	CDD:290200	11/24 (46%)
		C2H2 Zn finger	656..676	CDD:275368	7/19 (37%)
		zf-H2C2_2	668..690	CDD:290200	7/21 (33%)
		C2H2 Zn finger	684..704	CDD:275368	4/20 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24381
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100