DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6808 and cg

DIOPT Version :9

Sequence 1:	NP_001247055.1	Gene:	CG6808 / 41394	FlyBaseID:	FBgn0037921	Length:	375	Species:	Drosophila melanogaster
Sequence 2:	NP_001097306.2	Gene:	cg / 36571	FlyBaseID:	FBgn0000289	Length:	837	Species:	Drosophila melanogaster

Alignment Length:	133	Identity:	43/133 - (32%)
Similarity:	64/133 - (48%)	Gaps:	0/133 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   227 YRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRR 291
            |.|..|..::.....|..|::||..|:.|.|..|.|:|.....|.||:..|:.|:||||..|.:.
  Fly   292 YSCDECGKSFLLKHHLTTHARVHTGERPHICTHCGKSFAHKHCLNTHLLLHSTERPYQCQECKKS 356

  Fly   292 FADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTA 356
            |........|.|:|:.|||:.|..||:.|.|......|...|:.|:.:.|..|.:.|..::.|..
  Fly   357 FTLKHHLLTHSRVHSRERPFVCQECGRAFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIM 421

  Fly   357 HEK 359
            |.:
  Fly   422 HSR 424

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6808	NP_001247055.1	zf-AD	9..79	CDD:214871
		C2H2 Zn finger	229..249	CDD:275368	4/19 (21%)
		zf-C2H2	255..277	CDD:278523	8/21 (38%)
		C2H2 Zn finger	257..277	CDD:275368	7/19 (37%)
		zf-H2C2_2	269..293	CDD:290200	10/23 (43%)
		C2H2 Zn finger	285..305	CDD:275368	5/19 (26%)
		zf-H2C2_2	299..321	CDD:290200	9/21 (43%)
		C2H2 Zn finger	313..333	CDD:275368	6/19 (32%)
		C2H2 Zn finger	341..359	CDD:275368	5/17 (29%)
cg	NP_001097306.2	COG5048	287..>371	CDD:227381	26/78 (33%)
		C2H2 Zn finger	294..314	CDD:275368	4/19 (21%)
		zf-H2C2_2	306..331	CDD:290200	10/24 (42%)
		C2H2 Zn finger	322..342	CDD:275368	7/19 (37%)
		C2H2 Zn finger	350..370	CDD:275368	5/19 (26%)
		zf-H2C2_2	362..385	CDD:290200	9/22 (41%)
		C2H2 Zn finger	378..398	CDD:275368	6/19 (32%)
		zf-H2C2_2	390..415	CDD:290200	6/24 (25%)
		C2H2 Zn finger	406..426	CDD:275368	5/19 (26%)
		SIR2	<425..>465	CDD:294129	43/133 (32%)
		C2H2 Zn finger	434..454	CDD:275368
		C2H2 Zn finger	461..482	CDD:275368
		C2H2 Zn finger	490..509	CDD:275368
		lambda-1	491..>603	CDD:212564
		C2H2 Zn finger	575..595	CDD:275368
		C2H2 Zn finger	720..740	CDD:275368
		C2H2 Zn finger	752..771	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45440483
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930