DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and CG1663

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster


Alignment Length:369 Identity:79/369 - (21%)
Similarity:133/369 - (36%) Gaps:99/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LRSLVRQTLSSASAFETLEDKDQLEQKKRARKQN-ISGRLIEENPI-----NFKTQENALETTKD 135
            ::.|| |...:.|.|..  |:|:::.:.:....| ::..:.:|:.:     :||..|     ..:
  Fly     1 MKHLV-QRHGNESGFNA--DEDEIQDEVQVEMTNLLAASIAQESKLAEVQESFKNVE-----FME 57

  Fly   136 DEILPINKFSSDFVFDLNVNAENEKDIHQEDYTISDMDLDREISDQNYSETYS-QESSAAT---- 195
            :|:.|            |.:.|.|:. |.|..:.|..|.   ||:|.:...|| |.:|...    
  Fly    58 EEVEP------------NFSPEKEQG-HDELASNSHHDY---ISNQPHKAFYSLQRTSPGVIQYF 106

  Fly   196 -----------------------DSIQETSE----DYH-NLEPSA--------------DYVIDL 218
                                   ||.|:.:|    .:| .|:|..              .||:.|
  Fly   107 IQQLRRHKFFWITEHGINKKDRMDSSQKVAEALFHRFHFQLDPKVVNASARFLQVWFERQYVMQL 171

  Fly   219 GVA---CEPDKYR----------------CKICSNTYRCLSQLNAHS-QVHRKEKDHQCEVCQKT 263
            ..:   |...||.                |:.|...:.....|..|. :||.....:.|.||.::
  Fly   172 SSSDFRCRYPKYYHSLLKFMPTNHISVTICEECDRRFLNERLLRLHKFRVHGGPNPNVCHVCHQS 236

  Fly   264 FRAACNLKTHM-RTHTGEKPYQCCYCSRRFADNSTHRKHERLHTNERPYACNICGKTFSLSSSRN 327
            |..|..|:.|. |.|.....:||..|..........::|:.:|..:|.|.|.:||.:...||:..
  Fly   237 FPLASKLEQHQARYHFKRPEWQCSRCDYNAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALA 301

  Fly   328 AHYYLHSSEKSHKCLMCKKEFRLKHQLTAHEKSLAHRLIAKEYS 371
            .|...|...|. .|..|.::||....|.:|.:.:.....|::.|
  Fly   302 VHRRTHDQPKL-CCPHCSRQFRENSTLKSHIRKIHDGNSARQVS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 0/1 (0%)
C2H2 Zn finger 229..249 CDD:275368 4/20 (20%)
zf-C2H2 255..277 CDD:278523 8/22 (36%)
C2H2 Zn finger 257..277 CDD:275368 8/20 (40%)
zf-H2C2_2 269..293 CDD:290200 7/24 (29%)
C2H2 Zn finger 285..305 CDD:275368 3/19 (16%)
zf-H2C2_2 299..321 CDD:290200 7/21 (33%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 16/78 (21%)
C2H2 Zn finger 201..222 CDD:275368 4/20 (20%)
C2H2 Zn finger 259..279 CDD:275368 3/19 (16%)
C2H2 Zn finger 287..307 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3304
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.