DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and ZNF391

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001070249.1 Gene:ZNF391 / 346157 HGNCID:18779 Length:358 Species:Homo sapiens


Alignment Length:346 Identity:86/346 - (24%)
Similarity:140/346 - (40%) Gaps:82/346 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LRSLVRQTLSSASAFETLEDKDQLEQKKRA---RKQNISGRLIEENPINFK---TQENALETTKD 135
            :.||...|....:..|..:::.||.::.:.   :|.:....::.:..:..|   |.|...|    
Human     1 MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGPE---- 61

  Fly   136 DEILPINKFSSDFVFDLNVNAE--------------NEKD-----IHQEDYT----ISDMDLDRE 177
                     ||:|....|::|:              |.||     .||..::    ....:.::.
Human    62 ---------SSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKA 117

  Fly   178 ISDQN----YSETYSQESSAATDSIQET-SEDYHNLEPSADYVIDLGVACEPDKYRCKICSNTYR 237
            .|.|:    :|..:..|.....:...:: |...|.:|....:..:     :|  |.|..|...:.
Human   118 FSYQSDLLVHSRIHGGEKPFECNKCGKSFSRSTHLIEHQRTHTGE-----KP--YECNECGKAFS 175

  Fly   238 CLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRRFADNST---HR 299
            ..:.|:.|.::|..||.::|..|.|.|..:.||..|.||||.|:||:|..|.:.|.|.||   |:
Human   176 RSTHLSLHQRIHTGEKPYECSECGKAFSRSTNLSQHQRTHTQERPYKCNECGKAFGDRSTIIQHQ 240

  Fly   300 K-------------------------HERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSH 339
            :                         |:|.||.|.||.|:.|||.||.|||...|..:||.||.|
Human   241 RIHTGENPYECSKCGKAFSWISSLTEHQRTHTGENPYECSECGKVFSRSSSLTEHQRIHSGEKPH 305

  Fly   340 KCLMCKKEFRLKHQLTAHEKS 360
            :|.:|.|.|.....|..|:::
Human   306 ECRVCGKGFSRSSSLIIHQRT 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 0/1 (0%)
C2H2 Zn finger 229..249 CDD:275368 4/19 (21%)
zf-C2H2 255..277 CDD:278523 8/21 (38%)
C2H2 Zn finger 257..277 CDD:275368 8/19 (42%)
zf-H2C2_2 269..293 CDD:290200 12/23 (52%)
C2H2 Zn finger 285..305 CDD:275368 9/47 (19%)
zf-H2C2_2 299..321 CDD:290200 11/46 (24%)
C2H2 Zn finger 313..333 CDD:275368 10/19 (53%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)
ZNF391NP_001070249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..94 10/50 (20%)
C2H2 Zn finger 111..131 CDD:275368 3/19 (16%)
zf-H2C2_2 123..148 CDD:290200 2/24 (8%)
C2H2 Zn finger 139..159 CDD:275368 3/19 (16%)
zf-H2C2_2 151..176 CDD:290200 6/31 (19%)
COG5048 <163..340 CDD:227381 58/166 (35%)
C2H2 Zn finger 167..187 CDD:275368 4/19 (21%)
zf-H2C2_2 179..204 CDD:290200 9/24 (38%)
C2H2 Zn finger 195..215 CDD:275368 8/19 (42%)
zf-H2C2_2 207..230 CDD:290200 12/22 (55%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
zf-H2C2_2 238..259 CDD:290200 1/20 (5%)
C2H2 Zn finger 251..271 CDD:275368 2/19 (11%)
zf-H2C2_2 263..288 CDD:290200 12/24 (50%)
C2H2 Zn finger 279..299 CDD:275368 10/19 (53%)
zf-H2C2_2 291..316 CDD:290200 11/24 (46%)
C2H2 Zn finger 307..327 CDD:275368 6/20 (30%)
zf-H2C2_2 319..342 CDD:290200 2/8 (25%)
zf-C2H2 333..355 CDD:278523
C2H2 Zn finger 335..355 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.