DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and ZNF778

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001188336.1 Gene:ZNF778 / 197320 HGNCID:26479 Length:757 Species:Homo sapiens


Alignment Length:145 Identity:59/145 - (40%)
Similarity:81/145 - (55%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 IDLGVACEPDKYRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGE 280
            |.:....:|  |.||.|..|:...|.|..|.:.|..||.::|:||.|.|..:.:|..|:||||||
Human   580 IQIHTGIKP--YECKDCGKTFTVSSSLTEHIRTHTGEKPYECKVCGKAFTTSSHLIVHIRTHTGE 642

  Fly   281 KPYQCCYCSRRFADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCK 345
            |||.|..|.:.||.:|...:|.|.||.|:||.||.|||.|..||..:.|..:|:.:|.:||..|.
Human   643 KPYICKECGKAFASSSHLIEHRRTHTGEKPYICNECGKAFRASSHLHKHGRIHTGQKPYKCKECG 707

  Fly   346 KEFRLKHQLTAHEKS 360
            |.:...:.|..|.|:
Human   708 KAYNRFYLLKEHLKT 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871
C2H2 Zn finger 229..249 CDD:275368 7/19 (37%)
zf-C2H2 255..277 CDD:278523 8/21 (38%)
C2H2 Zn finger 257..277 CDD:275368 8/19 (42%)
zf-H2C2_2 269..293 CDD:290200 13/23 (57%)
C2H2 Zn finger 285..305 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
C2H2 Zn finger 341..359 CDD:275368 5/17 (29%)
ZNF778NP_001188336.1 KRAB 42..100 CDD:214630
C2H2 Zn finger 283..303 CDD:275368
C2H2 Zn finger 311..331 CDD:275368
C2H2 Zn finger 339..358 CDD:275368
C2H2 Zn finger 367..387 CDD:275368
COG5048 380..747 CDD:227381 59/145 (41%)
C2H2 Zn finger 395..415 CDD:275368
C2H2 Zn finger 423..443 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 479..499 CDD:275368
C2H2 Zn finger 507..527 CDD:275368
C2H2 Zn finger 535..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368 1/2 (50%)
C2H2 Zn finger 591..611 CDD:275368 7/19 (37%)
C2H2 Zn finger 619..639 CDD:275368 8/19 (42%)
C2H2 Zn finger 647..667 CDD:275368 7/19 (37%)
C2H2 Zn finger 675..695 CDD:275368 9/19 (47%)
C2H2 Zn finger 703..722 CDD:275368 5/18 (28%)
C2H2 Zn finger 731..751 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.