DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6808 and Zfp369

DIOPT Version :9

Sequence 1:	NP_001247055.1	Gene:	CG6808 / 41394	FlyBaseID:	FBgn0037921	Length:	375	Species:	Drosophila melanogaster
Sequence 2:	NP_848141.3	Gene:	Zfp369 / 170936	MGIID:	2176229	Length:	845	Species:	Mus musculus

Alignment Length:	137	Identity:	48/137 - (35%)
Similarity:	71/137 - (51%)	Gaps:	2/137 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   228 RCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRRF 292
            :|..|...:|.....:.|.::|..|:.:.|..|.|.|..:.:|..|:|.|:||:|::|..|.|.|
Mouse   702 QCSECGKMFRNARYFSVHKKIHTGERPYMCMSCGKAFVQSSSLTQHLRIHSGERPFECSECGRTF 766

  Fly   293 ADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAH 357
            :|.|...:|.|.||..:||.|..|||.|..||....|..:|:.|:.:.|..|.|.|.....|..|
Mouse   767 SDRSAASQHLRTHTGAKPYQCQHCGKAFRQSSHLTRHVRIHTGERPYVCTKCGKAFTQSSNLIGH 831

  Fly   358 EKSLAHR 364
            :|:  ||
Mouse   832 QKT--HR 836

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6808	NP_001247055.1	zf-AD	9..79	CDD:214871
		C2H2 Zn finger	229..249	CDD:275368	4/19 (21%)
		zf-C2H2	255..277	CDD:278523	7/21 (33%)
		C2H2 Zn finger	257..277	CDD:275368	7/19 (37%)
		zf-H2C2_2	269..293	CDD:290200	10/23 (43%)
		C2H2 Zn finger	285..305	CDD:275368	8/19 (42%)
		zf-H2C2_2	299..321	CDD:290200	10/21 (48%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		C2H2 Zn finger	341..359	CDD:275368	6/17 (35%)
Zfp369	NP_848141.3	KRAB	35..94	CDD:214630
		KRAB	35..74	CDD:279668
		SCAN	179..266	CDD:280241
		KRAB	300..>340	CDD:214630
		KRAB	300..339	CDD:279668
		C2H2 Zn finger	676..695	CDD:275370
		C2H2 Zn finger	703..723	CDD:275368	4/19 (21%)
		zf-H2C2_2	715..740	CDD:290200	7/24 (29%)
		COG5048	727..>792	CDD:227381	25/64 (39%)
		C2H2 Zn finger	731..751	CDD:275368	7/19 (37%)
		zf-H2C2_2	743..767	CDD:290200	10/23 (43%)
		zf-C2H2	757..779	CDD:278523	8/21 (38%)
		C2H2 Zn finger	759..779	CDD:275368	8/19 (42%)
		zf-C2H2	785..807	CDD:278523	9/21 (43%)
		C2H2 Zn finger	787..807	CDD:275368	8/19 (42%)
		zf-H2C2_2	799..824	CDD:290200	7/24 (29%)
		C2H2 Zn finger	815..835	CDD:275368	7/21 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000