DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6808 and ZNF891

DIOPT Version :9

Sequence 1:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001264220.1 Gene:ZNF891 / 101060200 HGNCID:38709 Length:544 Species:Homo sapiens


Alignment Length:392 Identity:98/392 - (25%)
Similarity:166/392 - (42%) Gaps:75/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEISIKWSMC--RTCRKKGTQSTLQSLF---ESNAHKL--LISYAGTSVKPDDGLPDQICTVCLM 58
            |:..|..::|  :..:.|..:||:|.:.   .|||.|:  |..:..:|...:|.           
Human   103 MKKRIPQAICPDQKIQPKTKESTVQKILWEEPSNAVKMIKLTMHNWSSTLREDW----------- 156

  Fly    59 QLEEVDRFLSACKQSDAHLRSLV---RQTLSSASAFETLEDKDQLEQKKRARKQNISGRLIEENP 120
               |..:.....|....|.|.::   ::|:..    |...|..:||:..:     :..:||....
Human   157 ---ECHKIRKQHKIPGGHWRQMIYAPKKTVPQ----ELFRDYHELEENSK-----LGSKLIFSQS 209

  Fly   121 INFKTQENALETTKDDEILPINKFSSDFVFDLNVNAENEK--DIHQEDYTISDMDLDREISDQNY 183
            |  .|.::..:...:...|..|...:::|    .|:.:||  :.|:.|.|:.....::.:..:  
Human   210 I--FTSKHCQKCYSEIGCLKHNSIINNYV----KNSISEKLYESHECDTTLWHFQRNQTVQKE-- 266

  Fly   184 SETYSQESSAATDSIQETSEDYHNLEPSADYVIDLGVACE---------------------PDKY 227
             .|||:.....|          ||:.|..:.:.....|||                     ..|:
Human   267 -YTYSKHGMHFT----------HNMFPVPNNLHMAQNACECNKDETLCHQSSLKKQGQTHTEKKH 320

  Fly   228 RCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRRF 292
            .|..|...::.:|.|..:.:.|..||.::|:.|.|.|..:..|:.|:|||||||||:|..|.:.|
Human   321 ECNQCGKAFKRISNLTLYKKSHMGEKQYECKECGKVFNDSSTLRRHVRTHTGEKPYECNQCGKAF 385

  Fly   293 ADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAH 357
            :..::.:.|.|.||.|:||.||.|||:|..||....|..:|:.||.::|..|.|.|.....|..|
Human   386 SQKTSLKAHMRTHTGEKPYECNQCGKSFGTSSYLIVHKRIHTGEKLYECSECGKAFNTSSHLKVH 450

  Fly   358 EK 359
            :|
Human   451 KK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 15/76 (20%)
C2H2 Zn finger 229..249 CDD:275368 4/19 (21%)
zf-C2H2 255..277 CDD:278523 7/21 (33%)
C2H2 Zn finger 257..277 CDD:275368 7/19 (37%)
zf-H2C2_2 269..293 CDD:290200 13/23 (57%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
C2H2 Zn finger 341..359 CDD:275368 6/17 (35%)
ZNF891NP_001264220.1 KRAB 43..99 CDD:214630
KRAB 43..82 CDD:279668
COG5048 <272..544 CDD:227381 59/191 (31%)
C2H2 Zn finger 295..315 CDD:275368 1/19 (5%)
C2H2 Zn finger 322..342 CDD:275368 4/19 (21%)
zf-C2H2 348..370 CDD:278523 7/21 (33%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
zf-H2C2_2 363..387 CDD:290200 14/23 (61%)
C2H2 Zn finger 378..398 CDD:275368 5/19 (26%)
zf-H2C2_2 390..415 CDD:290200 13/24 (54%)
C2H2 Zn finger 406..426 CDD:275368 9/19 (47%)
zf-H2C2_2 418..443 CDD:290200 8/24 (33%)
C2H2 Zn finger 434..454 CDD:275368 7/19 (37%)
zf-H2C2_2 446..470 CDD:290200 3/7 (43%)
C2H2 Zn finger 462..482 CDD:275368
zf-H2C2_2 474..498 CDD:290200
C2H2 Zn finger 490..510 CDD:275368
zf-H2C2_2 502..527 CDD:290200
C2H2 Zn finger 518..538 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.