DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and DOT5

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_172787.1 Gene:DOT5 / 837889 AraportID:AT1G13290 Length:302 Species:Arabidopsis thaliana


Alignment Length:238 Identity:51/238 - (21%)
Similarity:82/238 - (34%) Gaps:80/238 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GDEELLMSSAPSP---HPSFKMDKQKPGRPRKPDAELKFKR------------------KDINAK 248
            |||:.::.|...|   :||    ..|| ...||.::.:|..                  .|....
plant    11 GDEDSVVLSLGPPGQQYPS----HNKP-TSTKPSSDHEFNHPLTNPNGVTVALHIGPPSSDKETL 70

  Fly   249 ERGNQ-------------PKCKE----EEKFMCILCGNVFYKKSVFTAHMMTH-SEYK------- 288
            ..||.             |...:    ..:|.|.:|...|.:.:....||..| |:|:       
plant    71 SGGNNQEGLTARQGQYWIPSLSQILVGPTQFSCSVCNKTFNRFNNMQMHMWGHGSQYRKGPESLR 135

  Fly   289 -----------PHQC--EIC--------NKSFRQMGELRAHIRRHTGDRPYKC-MYCDRHFYDRS 331
                       |..|  |.|        :|..:....|:.|.:|..|.:|::| ..|::.|..|.
plant   136 GTKSSSSILRLPCYCCAEGCKNNIDHPRSKPLKDFRTLQTHYKRKHGAKPFRCRKKCEKTFAVRG 200

  Fly   332 ERVRHERVHTNTRPYACQECGKTFTHTAILKNHILS----HSA 370
            :...||:  ...:.:.| .||..|.|...||:|:.:    |:|
plant   201 DWRTHEK--NCGKLWFC-VCGSDFKHKRSLKDHVRAFGDGHAA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 35/144 (24%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-C2H2 290..312 CDD:278523 6/31 (19%)
C2H2 Zn finger 292..312 CDD:275368 6/29 (21%)
zf-H2C2_2 304..327 CDD:290200 7/23 (30%)
C2H2 Zn finger 320..340 CDD:275368 6/20 (30%)
zf-H2C2_2 335..357 CDD:290200 6/21 (29%)
C2H2 Zn finger 348..368 CDD:275368 8/23 (35%)
C2H2 Zn finger 376..395 CDD:275368
DOT5NP_172787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.