DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and ZNF232

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_055334.2 Gene:ZNF232 / 7775 HGNCID:13026 Length:444 Species:Homo sapiens


Alignment Length:461 Identity:108/461 - (23%)
Similarity:185/461 - (40%) Gaps:109/461 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILQCRICLGDFEESQMICLFGDKGESDLR----KKLELCC----------------------RIR 45
            ::|.|:.: ....::.:.|.|.:|:..:.    |:.|..|                      .:|
Human    23 LVQTRMAV-SLTAAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFRHLR 86

  Fly    46 VRQSPQLPEKACNS----CCEFVQMWFNFRQMCLNSQVYWETSSSERPEALAQASDAEYML---- 102
            .:::|. |.:|.:.    |||::                       |||...:....|:::    
Human    87 YQETPG-PREALSQLRVLCCEWL-----------------------RPEKHTKEQILEFLVLEQF 127

  Fly   103 --YLYENL-------HLKLGTENQEKEEITAIEEGDEQQEDQSQEVLDFNGFIINESIEEDE--- 155
              .|.|.|       |.|.|     :|.:|.:|:.::..|.:.|.....:|....|..|:.|   
Human   128 LTILPEELQSWVRGHHPKSG-----EEAVTVLEDLEKGLEPEPQVPGPAHGPAQEEPWEKKESLG 187

  Fly   156 ----------EPNTESP----EQILISHMDSYVDDQQMEELIDDKGELVEELSNANTFYEVEYGD 206
                      :|....|    ||:.: |..|.|.:...|.  .|||.|.:.   ..|..|.:...
Human   188 AAQEALSIQLQPKETQPFPKSEQVYL-HFLSVVTEDGPEP--KDKGSLPQP---PITEVESQVFS 246

  Fly   207 EELLMSSA---PSPHPSFKMDKQKPGRPR---KPDAELKFKRKDINAKERGNQPKCKEEEKFMCI 265
            |:|...::   .:...:.::.::.|...|   .|..|..|::..:..||   .|..|::.:  |.
Human   247 EKLATDTSTFEATSEGTLELQQRNPKAERLRWSPAQEESFRQMVVIHKE---IPTGKKDHE--CS 306

  Fly   266 LCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDR 330
            .||..|...|....|...||..||::|..|.|:|:|...|..|.|.|||::|::|..|.:.|...
Human   307 ECGKTFIYNSHLVVHQRVHSGEKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFECNECGKAFRWG 371

  Fly   331 SERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQT 395
            :..|:|:|:|:..:||.|.||||.|:.::.|..|...||.:|.:.|..|.|::....:|..|.: 
Human   372 AHLVQHQRIHSGEKPYECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRR- 435

  Fly   396 LTHRNK 401
             .|..|
Human   436 -VHARK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 15/103 (15%)
COG5048 <261..395 CDD:227381 47/133 (35%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 9/22 (41%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
zf-H2C2_2 335..357 CDD:290200 11/21 (52%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
C2H2 Zn finger 376..395 CDD:275368 5/18 (28%)
ZNF232NP_055334.2 SCAN 75..188 CDD:128708 26/141 (18%)
SCAN 75..162 CDD:280241 20/115 (17%)
COG5048 <303..409 CDD:227381 39/107 (36%)
zf-C2H2 303..325 CDD:278523 6/23 (26%)
C2H2 Zn finger 305..325 CDD:275368 6/19 (32%)
zf-H2C2_2 317..342 CDD:290200 9/24 (38%)
C2H2 Zn finger 333..353 CDD:275368 8/19 (42%)
zf-H2C2_2 345..368 CDD:290200 9/22 (41%)
C2H2 Zn finger 361..381 CDD:275368 6/19 (32%)
zf-H2C2_2 373..398 CDD:290200 12/24 (50%)
COG5048 385..>437 CDD:227381 18/53 (34%)
C2H2 Zn finger 389..409 CDD:275368 8/19 (42%)
zf-H2C2_2 401..424 CDD:290200 8/22 (36%)
C2H2 Zn finger 417..437 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.