DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and ZNF165

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001363420.1 Gene:ZNF165 / 7718 HGNCID:12953 Length:485 Species:Homo sapiens


Alignment Length:469 Identity:110/469 - (23%)
Similarity:180/469 - (38%) Gaps:114/469 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DFEESQMICLFGDKGESDLRKKLELCCRIRVRQ-----SPQLPEKACNS----CCEFVQMWFNFR 71
            :|...|..||    ..|:|.|: || ||...||     ||. |.:|.:.    ||::::...:.:
Human    28 EFIHGQDTCL----QRSELLKQ-EL-CRQLFRQFCYQDSPG-PREALSRLRELCCQWLKPEIHTK 85

  Fly    72 QMCLNSQV------------------YWETSSSERP---EALAQASDAEYMLYLYENLHLKLGTE 115
            :..|...|                  ::..|..|..   |.|.:.:| |.:|.:..:.|   |.|
Human    86 EQILELLVLEQFLTILPGDLQAWVHEHYPESGEEAVTILEDLERGTD-EAVLQVQAHEH---GQE 146

  Fly   116 NQEKE----------EITAIEEGDEQQEDQSQEVLDFNGFIINESIEEDEEPNTE-----SPEQI 165
            ..:|:          ::..:|........:.|.:.|.:    |||......|..|     ..::|
Human   147 IFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLLWDCD----NESENSRSMPKLEIFEKIESQRI 207

  Fly   166 LISHMDSYVDDQ--QMEELIDDKGELVEELSNANTFYEVEYGDEELLMSSAPS------------ 216
            :...:..|:.:.  :.:::....|.:..:       :|.|.|:.:.|.|:...            
Human   208 ISGRISGYISEASGESQDICKSAGRVKRQ-------WEKESGESQRLSSAQDEGFGKILTHKNTV 265

  Fly   217 -----PHP---------SFKMDKQKPGRPRKPDAELKFKRKDIN-----AKERGNQ-------PK 255
                 .|.         |.:...||..:....|...|:....||     |.|:.:|       ||
Human   266 RGEIISHDGCERRLNLNSNEFTHQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPK 330

  Fly   256 CKE-------EEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHT 313
            ..:       ::...|..||..|...|....|...|:..:.::|..|.|||.:..:|..|.|.||
Human   331 LAKHAAVFSGDKTHQCNECGKAFRHSSKLARHQRIHTGERCYECNECGKSFAESSDLTRHRRIHT 395

  Fly   314 GDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGI 378
            |:||:.|..|.|.|...|..:||:|:||..:||.|.||||||..::.|..|...|:.:|.|.|..
Human   396 GERPFGCKECGRAFNLNSHLIRHQRIHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSE 460

  Fly   379 CCKSFTLLHQLKAH 392
            |.::|:....|..|
Human   461 CGRAFSQSSNLSQH 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 21/93 (23%)
COG5048 <261..395 CDD:227381 49/132 (37%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 11/22 (50%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 335..357 CDD:290200 14/21 (67%)
C2H2 Zn finger 348..368 CDD:275368 9/19 (47%)
C2H2 Zn finger 376..395 CDD:275368 5/17 (29%)
ZNF165NP_001363420.1 SCAN 45..157 CDD:128708 25/118 (21%)
C2H2 Zn finger 297..314 CDD:275368 4/16 (25%)
zf-C2H2 344..366 CDD:333835 6/21 (29%)
C2H2 Zn finger 346..366 CDD:275368 6/19 (32%)
COG5048 370..>431 CDD:227381 25/60 (42%)
zf-C2H2 372..394 CDD:333835 8/21 (38%)
C2H2 Zn finger 374..394 CDD:275368 8/19 (42%)
C2H2 Zn finger 402..422 CDD:275368 8/19 (42%)
COG5048 426..>479 CDD:227381 19/49 (39%)
C2H2 Zn finger 430..450 CDD:275368 9/19 (47%)
C2H2 Zn finger 458..478 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.