DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG4936

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:500 Identity:130/500 - (26%)
Similarity:193/500 - (38%) Gaps:149/500 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSPQLPEKACNSCCEFVQMWFNFRQMC 74
            ||:||...:| .|..:|.|..|.||...:..|..:.::|....|:|.|..|.:.::|.|.||:.|
  Fly    23 CRVCLQQPKE-PMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETC 86

  Fly    75 LNS-----QVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEK-------EEITAIEE 127
            ..|     |........:||..                   |.|:|...|       :|.....|
  Fly    87 QRSYGHLRQFVGPVEVEQRPPE-------------------KKGSETATKLEPDVDPDEAEQEPE 132

  Fly   128 GDEQQED---------QSQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEE-- 181
            .||:.||         ::.:..:..|.:.::.||:......|....:       :|.::|:||  
  Fly   133 HDEEDEDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIV-------HVKNEQVEEDG 190

  Fly   182 ---------------LIDDKG-------ELVEELSNANTFYEVEYGDE---ELLMSSAPS----- 216
                           ||.|:|       :.:.|||     .|:||.|:   :.|..||..     
  Fly   191 IIEEVYDVYETYEGDLIPDQGYDHEMADQALSELS-----AEIEYLDQVEHDQLTESAHEDDAEV 250

  Fly   217 ----------PHPSFKMD---------KQKPGRPRKPDAELKFKRKDINAKERGNQPKC------ 256
                      |..|.:..         :..|.|.....|.:..:.......:|||..|.      
  Fly   251 DLNSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSD 315

  Fly   257 ---------------------------------------KEEEKFMCILCGNVFYKKSVFTAHMM 282
                                                   |:|.|::|.:|||::..:|..|.|:.
  Fly   316 SAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIK 380

  Fly   283 THSEYKPHQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYA 347
            .||..|||:||||...|.|..:|..|:..|||:|||||.||...|.|.|.|.:|.|:|||.|||.
  Fly   381 VHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYE 445

  Fly   348 CQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAH 392
            |..|.||||:|..||.|.:.|:.:|.:.|.:|.|.|...::|:.|
  Fly   446 CDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNH 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 24/77 (31%)
COG5048 <261..395 CDD:227381 60/131 (46%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-C2H2 290..312 CDD:278523 9/21 (43%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 12/22 (55%)
C2H2 Zn finger 320..340 CDD:275368 9/19 (47%)
zf-H2C2_2 335..357 CDD:290200 13/21 (62%)
C2H2 Zn finger 348..368 CDD:275368 10/19 (53%)
C2H2 Zn finger 376..395 CDD:275368 5/16 (31%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 23/72 (32%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 12/23 (52%)
COG5048 386..>447 CDD:227381 33/60 (55%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 12/22 (55%)
C2H2 Zn finger 418..438 CDD:275368 9/19 (47%)
zf-H2C2_2 432..455 CDD:290200 13/22 (59%)
C2H2 Zn finger 446..466 CDD:275368 10/19 (53%)
zf-H2C2_2 459..481 CDD:290200 8/21 (38%)
C2H2 Zn finger 474..494 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11976
eggNOG 1 0.900 - - E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I3338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006293
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.