DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG4424

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:415 Identity:123/415 - (29%)
Similarity:189/415 - (45%) Gaps:112/415 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPVILQCRICLGDFEESQMICLF---GDK--GESDLRKKLELCCRIRVRQSPQ---LPEKACNSC 60
            |.::..||.||.| .|:.|:.:|   .|:  |...|..|:|....|::|.:.:   ||.:.|..|
  Fly     5 LNMMTLCRTCLQD-GEAHMVSIFQTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPTRICLRC 68

  Fly    61 CEFVQMWFNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAI 125
            ..|:.:...|||:|..|..:..                ||::                |:   |:
  Fly    69 KAFLTLAHKFRQICQRSNEFLR----------------EYVI----------------KD---AV 98

  Fly   126 EEGDEQQEDQSQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELV 190
            |:|                 ::.|.::: ..|:|..|           ::.:|:|...|   |::
  Fly    99 EQG-----------------VVKEVVQQ-TRPSTPPP-----------IETEQLEPPED---EVL 131

  Fly   191 EE--LSNANTFYEVEYGDEE------LLMSSAPSPHPSFKMDKQKPGR--PRKPDAELKFKRKDI 245
            ||  .|..:...|..:|..|      |.:...|:|:|       .|..  |..|...:|.|    
  Fly   132 EEGVWSTEDPIEETPHGPAEKERPTVLTVEMLPAPYP-------PPASTPPPAPAGAVKGK---- 185

  Fly   246 NAKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIR 310
                           ..:|.:|||.:.:||....||..|::.:|::||||:|||....:|:.|||
  Fly   186 ---------------LHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIR 235

  Fly   311 RHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYN 375
            :|||.:||.|.||.|:|.||:..|:|||.|.|.|||||:.|||.||:.::||.|..:|:.:|.:.
  Fly   236 QHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHI 300

  Fly   376 CGICCKSFTLLHQLKAHLQTLTHRN 400
            |.:|.|||..:|.|.|||||..|.|
  Fly   301 CQLCNKSFARIHNLVAHLQTQQHIN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 25/81 (31%)
COG5048 <261..395 CDD:227381 64/133 (48%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
zf-C2H2 290..312 CDD:278523 11/21 (52%)
C2H2 Zn finger 292..312 CDD:275368 11/19 (58%)
zf-H2C2_2 304..327 CDD:290200 13/22 (59%)
C2H2 Zn finger 320..340 CDD:275368 11/19 (58%)
zf-H2C2_2 335..357 CDD:290200 14/21 (67%)
C2H2 Zn finger 348..368 CDD:275368 9/19 (47%)
C2H2 Zn finger 376..395 CDD:275368 10/18 (56%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 25/98 (26%)
C2H2 Zn finger 189..209 CDD:275368 8/19 (42%)
DUF45 <204..281 CDD:302795 41/76 (54%)
COG5048 210..>345 CDD:227381 59/116 (51%)
C2H2 Zn finger 217..237 CDD:275368 11/19 (58%)
C2H2 Zn finger 245..265 CDD:275368 11/19 (58%)
zf-H2C2_2 257..282 CDD:290200 15/24 (63%)
C2H2 Zn finger 273..293 CDD:275368 9/19 (47%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..320 CDD:275368 10/18 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.