DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG17803

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:472 Identity:110/472 - (23%)
Similarity:178/472 - (37%) Gaps:115/472 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PVILQCRIC---LGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQS-PQLPEKACNSCCEFVQ 65
            |...:||.|   :...|::|.:.   |:....|...:::...:.::|. .:||...|::|.|.|.
  Fly    81 PPASKCRTCFRIISRHEDAQDLY---DRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETVN 142

  Fly    66 MWFNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDE 130
            ....||..|  .||         .:.|.|.:         |..::::..|..|.|....:.|...
  Fly   143 KSMEFRAKC--QQV---------DKKLRQTT---------EKYNIQICDEEMESELENVLYEESA 187

  Fly   131 QQ-------EDQSQEVL-DFNGFIINESIEEDEEPNTESPEQILISHMDSYVD-----------D 176
            ||       ||.|.|:| |..|.     ::||:.|....|.|..:|..:..:|           :
  Fly   188 QQAKGVVGLEDFSSELLPDSEGV-----LDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQN 247

  Fly   177 QQMEELID-DKGELVEELSNAN---TFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAE 237
            :...|:|. .|.:..||:...:   ..|:|..|:...|..:||         |.....|:||...
  Fly   248 KSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAP---------KYSLSLPKKPQLR 303

  Fly   238 LKFKRKDINAKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQM 302
            :..:.|:...:|| .|.|   ...::|..||:.|.::|....|::.|:..|..:|..|.|.|..:
  Fly   304 VSPEEKNRRRRER-IQAK---PLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDL 364

  Fly   303 GELRAHIRR-HTGDRPYKCMYCDRHFYDRSERVRHER---------------------------- 338
            .....|:|. |.|:.|:.|.:|:..|.:.|.|.||||                            
  Fly   365 YTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQC 429

  Fly   339 ---------------VHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQ 388
                           .|..:||:.|:.|...|...:.:|.|...|. :....|.||.|.|.|..|
  Fly   430 TKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALHD-KFPIRCDICLKGFLLRSQ 493

  Fly   389 LKAH--LQTLTHRNKME 403
            |..|  :.|..|.::.|
  Fly   494 LTKHQDVHTGMHPHRCE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 19/77 (25%)
COG5048 <261..395 CDD:227381 44/179 (25%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 6/22 (27%)
C2H2 Zn finger 292..312 CDD:275368 6/20 (30%)
zf-H2C2_2 304..327 CDD:290200 7/23 (30%)
C2H2 Zn finger 320..340 CDD:275368 9/62 (15%)
zf-H2C2_2 335..357 CDD:290200 10/64 (16%)
C2H2 Zn finger 348..368 CDD:275368 5/19 (26%)
C2H2 Zn finger 376..395 CDD:275368 9/20 (45%)
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 20/87 (23%)
COG5048 <323..528 CDD:227381 47/189 (25%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 6/20 (30%)
C2H2 Zn finger 383..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 426..446 CDD:275368 0/19 (0%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 9/19 (47%)
C2H2 Zn finger 509..528 CDD:275368 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.