DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG6813

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:400 Identity:96/400 - (24%)
Similarity:144/400 - (36%) Gaps:118/400 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILQCRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSPQLPEKACNSCCEFVQMWFNFR 71
            ||.||||   ......|.||| .|...|.:::.....:.:....::..:.|.:|.:.:|....||
  Fly     3 ILNCRIC---SRSDAPIDLFG-PGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFR 63

  Fly    72 QMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDEQQEDQS 136
            |.|:.:                                        ||:.:              
  Fly    64 QRCIIA----------------------------------------EKQNL-------------- 74

  Fly   137 QEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVEELSNANTFYE 201
                        |.||.|.:..:..|    |.:.|  :||.|:|..:|: ..|..|:        
  Fly    75 ------------ERIECDSKDCSTDP----IIYED--IDDNQIESELDE-SILCPEV-------- 112

  Fly   202 VEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKERGNQPKCKEEEKFMCIL 266
                 ::|.|.||........::.|                |.|..   |..|       ::|..
  Fly   113 -----KDLPMPSAEKVSAPTSLNHQ----------------KSIGG---GTGP-------YVCPD 146

  Fly   267 CGNVFYKKSVFTAHMMTHSEYKPHQCEI--CNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYD 329
            ||.:...||.|..|.:.|:..|...|..  |.:||....||.:|.|.|||::||.|:||.|.|..
  Fly   147 CGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSS 211

  Fly   330 RSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQ 394
            ...|..|.|.|.|.|.|.|..|.|:|..:..|:.|.:.|...:|:.|.:|.|.|..:..|..||.
  Fly   212 SGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLS 276

  Fly   395 TLTHRNKMEQ 404
            :..|:.|.|:
  Fly   277 SNIHKRKEEK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 17/73 (23%)
COG5048 <261..395 CDD:227381 49/135 (36%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-C2H2 290..312 CDD:278523 8/23 (35%)
C2H2 Zn finger 292..312 CDD:275368 8/21 (38%)
zf-H2C2_2 304..327 CDD:290200 13/22 (59%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 335..357 CDD:290200 10/21 (48%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
C2H2 Zn finger 376..395 CDD:275368 7/18 (39%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 19/139 (14%)
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 8/21 (38%)
zf-H2C2_2 186..211 CDD:290200 14/24 (58%)
UFD2 <256..>294 CDD:227443 10/30 (33%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.