DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG6689

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster


Alignment Length:439 Identity:107/439 - (24%)
Similarity:161/439 - (36%) Gaps:97/439 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPVILQCRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSPQLPEKACNSCCEFVQMWF 68
            |..:.:||.|..||..........|...|.|...:|:...:.:...|..|...|.:|...:....
  Fly   161 LEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAI 225

  Fly    69 NFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDEQQE 133
            :||:||:::::   ..|..:|.......:||....:..:..|...|||...|||.  :.|.:..|
  Fly   226 DFREMCISTEL---KLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIE--DAGGDHVE 285

  Fly   134 DQ-------SQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVE 191
            |:       |||.:|          |..|.|..:.|..:.:.       .:..:||:|       
  Fly   286 DEATSDDQTSQEAVD----------EVAESPAAQDPLSVALG-------AKIFKELLD------- 326

  Fly   192 ELSNANTFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKERGNQPKC 256
                       :|..:|.......:|..|....|:|....:||              :|...||.
  Fly   327 -----------QYTGKEKARLRKGAPIASKPKAKEKAAGEQKP--------------KRSANPKT 366

  Fly   257 KEEE-------------KFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAH 308
            |||.             .|:|..||..|........||:.|:..|.:||..|.|:|........|
  Fly   367 KEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMH 431

  Fly   309 IR-RHTGDRPYKCMYCDRHFYDRSERVRHE-RVHT----------NTRP---------YACQECG 352
            || ||.|:.|:.|.:|...|.....|.:|| .||.          |.:|         |.|:.|.
  Fly   432 IRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQ 496

  Fly   353 KTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRNK 401
            |.:.....|..||.||:....|.|..|.||::..::||.|  .:||..:
  Fly   497 KHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRH--EMTHEKR 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 17/73 (23%)
COG5048 <261..395 CDD:227381 48/154 (31%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 8/22 (36%)
C2H2 Zn finger 292..312 CDD:275368 7/20 (35%)
zf-H2C2_2 304..327 CDD:290200 9/23 (39%)
C2H2 Zn finger 320..340 CDD:275368 6/20 (30%)
zf-H2C2_2 335..357 CDD:290200 10/41 (24%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
C2H2 Zn finger 376..395 CDD:275368 7/18 (39%)
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 17/75 (23%)
zf-C2H2 385..407 CDD:278523 7/21 (33%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 399..422 CDD:290200 8/22 (36%)
C2H2 Zn finger 415..436 CDD:275368 7/20 (35%)
C2H2 Zn finger 444..460 CDD:275368 4/15 (27%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 7/21 (33%)
C2H2 Zn finger 547..567 CDD:275368
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.