DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and rn

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001262343.1 Gene:rn / 40879 FlyBaseID:FBgn0267337 Length:952 Species:Drosophila melanogaster


Alignment Length:159 Identity:55/159 - (34%)
Similarity:76/159 - (47%) Gaps:6/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 KEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHTGDRPYKCM 321
            :|.:.:.|..|...|...|..:.|...|...||::||||.:.|.|:..|:.|||.||||:||||.
  Fly   512 REAKPYKCTQCSKAFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCR 576

  Fly   322 Y--CDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKN---YNCGICCK 381
            :  |.:.|...|....|.|.|...:|:.|..|.|.|:....|..||..|...|:   :.|..|.|
  Fly   577 HPGCQKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEPSLLEHIPKHKESKHLKTHICQYCGK 641

  Fly   382 SFTLLHQLKAHLQTLTHR-NKMEQTIPSS 409
            |:|....|..|:|....| :|....:|.|
  Fly   642 SYTQETYLTKHMQKHAERTDKRPPIVPGS 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 49/138 (36%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-C2H2 290..312 CDD:278523 10/21 (48%)
C2H2 Zn finger 292..312 CDD:275368 10/19 (53%)
zf-H2C2_2 304..327 CDD:290200 13/24 (54%)
C2H2 Zn finger 320..340 CDD:275368 6/21 (29%)
zf-H2C2_2 335..357 CDD:290200 8/21 (38%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
C2H2 Zn finger 376..395 CDD:275368 7/18 (39%)
rnNP_001262343.1 C2H2 Zn finger 490..510 CDD:275368
C2H2 Zn finger 519..539 CDD:275368 5/19 (26%)
zf-H2C2_2 531..556 CDD:290200 9/24 (38%)
zf-C2H2 545..567 CDD:278523 10/21 (48%)
C2H2 Zn finger 547..567 CDD:275368 10/19 (53%)
zf-C2H2_8 550..630 CDD:292531 30/79 (38%)
zf-H2C2_2 559..586 CDD:290200 14/26 (54%)
C2H2 Zn finger 575..597 CDD:275368 6/21 (29%)
C2H2 Zn finger 605..625 CDD:275368 7/19 (37%)
C2H2 Zn finger 636..656 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.