DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and Neu2

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:178 Identity:56/178 - (31%)
Similarity:86/178 - (48%) Gaps:20/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 KDINAKER-----------GNQP-------KCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKP 289
            :::.|.||           ||:|       |.||:..|.|..|...|..||....||.:|:..:|
  Fly    82 EEVEAAERDLQDGADDVDSGNEPDINECDIKAKEKPGFSCSHCPKSFQVKSNLKVHMRSHTGERP 146

  Fly   290 HQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKT 354
            ..|.:|.|||.....|:.|:|.|||:||::|.:|.|.|........|.::|.......|..|.|.
  Fly   147 FTCSLCPKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFTAGHHLKAHIQMHERRGSLRCPYCQKC 211

  Fly   355 FTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRNKM 402
            |..:.|||.|:.:|:.:..:.|..|.|||.:.|:|..|::  .|:.::
  Fly   212 FLTSLILKQHLATHTDETQFKCSQCSKSFQVEHELWMHMR--VHQERL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 46/133 (35%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 11/22 (50%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 335..357 CDD:290200 6/21 (29%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
C2H2 Zn finger 376..395 CDD:275368 8/18 (44%)
Neu2NP_649316.1 zf-AD 1..63 CDD:285071
COG5048 <119..241 CDD:227381 42/121 (35%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-H2C2_2 133..158 CDD:290200 9/24 (38%)
C2H2 Zn finger 149..169 CDD:275368 8/19 (42%)
zf-H2C2_2 162..185 CDD:290200 11/22 (50%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
zf-C2H2_8 206..286 CDD:292531 17/54 (31%)
C2H2 Zn finger 233..253 CDD:275368 8/21 (38%)
C2H2 Zn finger 260..297 CDD:275368
C2H2 Zn finger 303..323 CDD:275368
C2H2 Zn finger 353..373 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.