DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG17385

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:194 Identity:65/194 - (33%)
Similarity:96/194 - (49%) Gaps:16/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 RKPDAELKFKR-KDINAKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEIC 295
            ::.|...:.|| :.::.:|..|..|...|    |.||...|........||..|::.:|..|.||
  Fly    19 KRCDRTFRSKRDQTLHRQEVHNHNKTTYE----CKLCAKSFCNSGNLDRHMKVHNDVRPFVCNIC 79

  Fly   296 NKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAI 360
            :|:|.|...|:.|...|:|:||:.|.:|::.|..:|...||:..||..:|:.||.||:.|:....
  Fly    80 SKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVN 144

  Fly   361 LKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTH-RNKMEQTIPSS--------PEMLES 415
            ||.|.|.|...|.|.|..|.|.||.|...|.|||  :| :..::..:|:|        .|.|||
  Fly   145 LKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQ--SHIKEGVDVDVPASIQAAAALARERLES 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 50/133 (38%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 8/22 (36%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
zf-H2C2_2 335..357 CDD:290200 10/21 (48%)
C2H2 Zn finger 348..368 CDD:275368 9/19 (47%)
C2H2 Zn finger 376..395 CDD:275368 9/18 (50%)
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 58/167 (35%)
C2H2 Zn finger 18..39 CDD:275368 4/19 (21%)
C2H2 Zn finger 48..68 CDD:275368 6/19 (32%)
C2H2 Zn finger 76..96 CDD:275368 8/19 (42%)
C2H2 Zn finger 104..124 CDD:275368 6/19 (32%)
C2H2 Zn finger 132..148 CDD:275368 7/15 (47%)
C2H2 Zn finger 160..180 CDD:275368 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.