DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG30431

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:415 Identity:103/415 - (24%)
Similarity:171/415 - (41%) Gaps:74/415 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQCRICLGDFEESQMICLFGDKGESDLRKKLE-LCCRIRVRQSPQLPEKACNSCCEFVQMWFNFR 71
            |.||.||  .|:..:.....| ..|.|..:|: |...:|:.....|.:..|:.|...:....:|:
  Fly    10 LVCRCCL--LEQPPLYHSLYD-ASSQLAVELKALAPALRLEHGDNLTDVICDLCLRRLHDARDFQ 71

  Fly    72 QMCLNSQ-------VYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGD 129
            :.|.:|:       .:|:.:.:. .:|||.....|.:.....:|...:....|..:.:..:.   
  Fly    72 RRCEHSEQVLRMRHEHWKHTVAV-GDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVA--- 132

  Fly   130 EQQEDQSQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVEELS 194
                 ...|.:||      ||::..:..::|..   :.|:.:|.|          |.|.|     
  Fly   133 -----PLMETVDF------ESLDFQDSSHSEHD---IPSYWESSV----------DSGSL----- 168

  Fly   195 NANT-FYEVEYGDEELLMSSAPSPHPS--------FKMDKQKPGRPRKPDAELKFKRKDINAKER 250
              || .::.|  ..||.....|:|..|        .:..|.:..|||:.:.:.| :||...|...
  Fly   169 --NTPHHQPE--TAELFAVEPPTPPESSEEPAPDAAEKPKMRRARPRQDNVKPK-ERKASGAVHP 228

  Fly   251 GNQPKCKE-EEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRR-HT 313
            .:...|.| |:||    ..|...|..:...|.|....|   |||.|.|:|.....||.|::. |:
  Fly   229 RSLHPCPECEKKF----TRNFQLKLHMTAVHGMGEMRY---QCEECRKNFASRHSLRYHVKSVHS 286

  Fly   314 GDRPYKCMYCDRHFYDRSERVRHERVHT---NTRPYACQECGKTFTHTAILKNHILSH--SAQKN 373
            .:||:.|.:|||.|..|::.:.|.|.||   ..|.:.||.|.|::...:.|:.|:.||  :.::.
  Fly   287 TERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERP 351

  Fly   374 YNCGICCKSFTLLHQLKAHLQTLTH 398
            :.|..|.|:|.....|.:||  |.|
  Fly   352 FKCDRCSKAFFTRGHLNSHL--LVH 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 18/81 (22%)
COG5048 <261..395 CDD:227381 45/139 (32%)
C2H2 Zn finger 264..284 CDD:275368 4/19 (21%)
zf-C2H2 290..312 CDD:278523 9/22 (41%)
C2H2 Zn finger 292..312 CDD:275368 8/20 (40%)
zf-H2C2_2 304..327 CDD:290200 10/23 (43%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 335..357 CDD:290200 9/24 (38%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
C2H2 Zn finger 376..395 CDD:275368 7/18 (39%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 17/73 (23%)
C2H2 Zn finger 234..255 CDD:275368 7/24 (29%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-C2H2_8 305..373 CDD:292531 20/69 (29%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 8/21 (38%)
zf-H2C2_2 366..389 CDD:290200 5/11 (45%)
C2H2 Zn finger 382..403 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.