DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG9215

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster


Alignment Length:460 Identity:124/460 - (26%)
Similarity:195/460 - (42%) Gaps:83/460 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRICLGDFEESQMICLFGDKGESD---LRKKLELCCRIRVRQSP-QL---PEKACNSCCEFVQMW 67
            |.:||.  ||.:...::|...||.   :..|:..|..:::..|| ||   |:|.|..|...:.:.
  Fly    16 CLVCLA--EEPEASSIYGHDPESPHMLILDKIRCCTSLQLDSSPSQLQRWPDKICKQCHLELSVS 78

  Fly    68 FNFRQMCLNSQVYWETSSSERPE----ALAQASDAEYMLYLYENLHLKLGTENQEKEEITA---- 124
            :.|.:.|...|..:.::|.....    |.|.|:....||...:...|||..| |....:.|    
  Fly    79 YRFHEKCTAVQKLFRSASRSTSTSAVFAAAAAAPPAPMLVDKQQEQLKLDLE-QAHVRLPATLKI 142

  Fly   125 ----------------IEEGDEQQEDQSQE-------------VLDFNGFIINESI---EEDEEP 157
                            |....|..||..:|             ||..|.|...:||   .|:::|
  Fly   143 RRLNVEPCSSSSVSGTITTSTEPSEDVKEEKTDSLSLIPDGAMVLSLNDFQAQDSITQQAEEKDP 207

  Fly   158 NTESPE---QILISHMDSYVDDQQMEELIDDKGELVEELSNANTFYEVEYGDEELLMSSAPSP-- 217
            ..:..|   |..:..:|.:.|:...|.|.:.:..|:                ||.:::|.|.|  
  Fly   208 KKQQDEDEGQAKMLELDPWDDENTPEHLYEIETPLI----------------EESVVASPPLPLP 256

  Fly   218 --HPSFKMDKQKPGRPRKPDAELKFKR------KDINAKERGNQPKCKEEEKFMCILCGNVFYKK 274
              ||:   ::||....|:....:|.::      .|..|.....:..|:...| :|.:|||.:..:
  Fly   257 PTHPA---NQQKKRTYRRVSPNVKHEKLTANVDDDFKAGSTTKRRNCERSPK-ICDVCGNTYKYQ 317

  Fly   275 SVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERV 339
            ....|||..|:..:|:.||:|.|:|....|||.|:|.|||.:||.|.:|:|.|.|.....:|||:
  Fly   318 HALNAHMRRHNNERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERI 382

  Fly   340 HTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRNKMEQ 404
            ||..|||.|:.|.|.|.:..:|..|..:|:.:|.:.|..|.|.||....|.||::........|.
  Fly   383 HTGERPYVCEVCNKGFAYAHVLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAHMEQHRGSGNGEA 447

  Fly   405 TIPSS 409
            ::.||
  Fly   448 SVASS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 21/79 (27%)
COG5048 <261..395 CDD:227381 54/133 (41%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-C2H2 290..312 CDD:278523 10/21 (48%)
C2H2 Zn finger 292..312 CDD:275368 10/19 (53%)
zf-H2C2_2 304..327 CDD:290200 13/22 (59%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 335..357 CDD:290200 12/21 (57%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
C2H2 Zn finger 376..395 CDD:275368 8/18 (44%)
CG9215NP_573045.1 zf-AD 16..92 CDD:285071 21/77 (27%)
DUF2117 165..>273 CDD:303038 28/126 (22%)
COG5048 <303..439 CDD:227381 54/136 (40%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
zf-H2C2_2 319..344 CDD:290200 10/24 (42%)
zf-C2H2 333..355 CDD:278523 10/21 (48%)
C2H2 Zn finger 335..355 CDD:275368 10/19 (53%)
zf-H2C2_2 347..371 CDD:290200 13/23 (57%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-H2C2_2 375..400 CDD:290200 12/24 (50%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 404..427 CDD:290200 7/22 (32%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I8439
eggNOG 1 0.900 - - E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4797
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.