DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG42726

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:239 Identity:61/239 - (25%)
Similarity:105/239 - (43%) Gaps:41/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VDDQQMEE-----------LIDDKGELV-----EELSNANTFYEVEYGDEELLMSSAPSPHPSFK 222
            ||.|:.:|           ::.|||...     :..|....:|.:..|::.|.           |
  Fly    47 VDIQETQETQARTSADKRIIVTDKGYHCTVCNKDFRSRTQQYYHLTCGNDLLK-----------K 100

  Fly   223 MDKQKPGRPRKPDAELKFKRKDINAKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEY 287
            .:.::.||.....:.||:   .:.:.|:        :.|..|.:|...|.:..|...||:||::.
  Fly   101 FNCKECGRRFATSSHLKY---HLMSHEK--------QSKHSCSVCHKSFKQPIVLQRHMLTHNQE 154

  Fly   288 KPHQCEICNKSFRQMGELRAHIRRHTG-DRPYKCMYCDRHFYDRSERVRHERVH-TNTRPYACQE 350
            | |.|.||.|.||:...|.:|:..|:. ...:||..|.:||.:::...:|.|.| .|...:.|:.
  Fly   155 K-HLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKV 218

  Fly   351 CGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQ 394
            |.|:|.....|:.|:..||.::..:|.:|.||:.....|..||:
  Fly   219 CQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 44/136 (32%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 9/21 (43%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 6/23 (26%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
zf-H2C2_2 335..357 CDD:290200 8/22 (36%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
C2H2 Zn finger 376..395 CDD:275368 7/19 (37%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 2/19 (11%)
C2H2 Zn finger 103..123 CDD:275368 4/22 (18%)
COG5048 <112..288 CDD:227381 47/163 (29%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 33/103 (32%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
C2H2 Zn finger 187..207 CDD:275368 6/19 (32%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.