DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG2120

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:325 Identity:73/325 - (22%)
Similarity:117/325 - (36%) Gaps:103/325 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 NESIEEDEEPNTESPEQILISHMDSYVDD----QQMEELIDDKGELVEELSNANTFYEVEYGDEE 208
            |.::.:|:           :.:.|..::|    .|:|:|..::..:..||.|..:    ||...|
  Fly    12 NATLADDD-----------LGNYDVCLEDLQLFAQLEDLSGERLPMEMELLNPGS----EYDLLE 61

  Fly   209 LLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKER--GNQPKC--------------- 256
            |:..:.          :|:.....||....|.||.....:.|  |....|               
  Fly    62 LVNGAL----------QQRNTTEHKPTDMCKPKRTPTTKRHRTTGKDHTCDICDRRFSEAYNLRI 116

  Fly   257 -----KEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHTGDR 316
                 .:|:..:|:.||..|.:.:....|.:||:..:||:|:||.|.||....|..|.|.|||::
  Fly   117 HKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEK 181

  Fly   317 PYKCMYCDRHFYDRSERVR---------------------------------------------- 335
            ||.|:..|.|....|...|                                              
  Fly   182 PYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQC 246

  Fly   336 ----HERVHTNTRPYAC--QECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQ 394
                |.:.|.|.|.:.|  .||||.|...:.||:|.::|:.|:.:.|.:|...|......|.||:
  Fly   247 YLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLK 311

  Fly   395  394
              Fly   312  311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 49/186 (26%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-C2H2 290..312 CDD:278523 10/21 (48%)
C2H2 Zn finger 292..312 CDD:275368 9/19 (47%)
zf-H2C2_2 304..327 CDD:290200 10/22 (45%)
C2H2 Zn finger 320..340 CDD:275368 6/69 (9%)
zf-H2C2_2 335..357 CDD:290200 11/73 (15%)
C2H2 Zn finger 348..368 CDD:275368 9/21 (43%)
C2H2 Zn finger 376..395 CDD:275368 6/19 (32%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 1/19 (5%)
zf-H2C2_2 113..138 CDD:290200 5/24 (21%)
C2H2 Zn finger 129..149 CDD:275368 5/19 (26%)
zf-H2C2_2 142..166 CDD:290200 10/23 (43%)
COG5048 151..>264 CDD:227381 25/112 (22%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 5/20 (25%)
C2H2 Zn finger 235..255 CDD:275368 1/19 (5%)
C2H2 Zn finger 263..285 CDD:275368 9/21 (43%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.