DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and CG32772

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster


Alignment Length:404 Identity:95/404 - (23%)
Similarity:136/404 - (33%) Gaps:130/404 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSPQLPEKACNSCCEFVQMWFNFRQMC 74
            ||:|.      |...||...|.|     :..|    ||.|.||...:            ||.|..
  Fly     5 CRLCF------QTATLFQVPGYS-----IPTC----VRCSEQLTNNS------------NFHQSA 42

  Fly    75 LNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDEQQEDQSQEV 139
            ..:.....::|:....:.|.|:.:               :......:..||.:..:.|..|.|: 
  Fly    43 AAAAAVAASASAAVAASAAAAATS---------------SSTASSSDSDAIAQQQQHQNPQQQQ- 91

  Fly   140 LDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVEELSNANTFYEVEY 204
                                         |.:|....||.::                       
  Fly    92 -----------------------------HQNSQQQQQQQQQ----------------------- 104

  Fly   205 GDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKERGNQPKCKEEEKFMCILCGN 269
                 :.||:.|.:...:.|.:        |.:|.|       .|.|:           |.||..
  Fly   105 -----MQSSSSSENLQSQDDSE--------DVDLIF-------NEEGS-----------CPLCNK 138

  Fly   270 VFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERV 334
            .|.:||....|:..||..:...|..|:|.|.|...||.|.|.||.||||:|:.|.:.|...:...
  Fly   139 TFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLN 203

  Fly   335 RHERVHTNTRPYACQ--ECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLT 397
            .|.|:||..||:.|.  |||::|.....|.||:.||...:.|.|.:|.|.||.:..|..|||  .
  Fly   204 NHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQ--A 266

  Fly   398 HRNKMEQTIPSSPE 411
            |........|..||
  Fly   267 HAGVTGYYCPRCPE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 17/72 (24%)
COG5048 <261..395 CDD:227381 52/135 (39%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-C2H2 290..312 CDD:278523 9/21 (43%)
C2H2 Zn finger 292..312 CDD:275368 9/19 (47%)
zf-H2C2_2 304..327 CDD:290200 12/22 (55%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 335..357 CDD:290200 11/23 (48%)
C2H2 Zn finger 348..368 CDD:275368 8/21 (38%)
C2H2 Zn finger 376..395 CDD:275368 8/18 (44%)
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 61/177 (34%)
C2H2 Zn finger 133..153 CDD:275368 7/19 (37%)
zf-H2C2_2 145..170 CDD:290200 7/24 (29%)
C2H2 Zn finger 161..181 CDD:275368 9/19 (47%)
zf-H2C2_2 173..198 CDD:290200 13/24 (54%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
C2H2 Zn finger 217..239 CDD:275368 8/21 (38%)
zf-H2C2_2 231..256 CDD:290200 10/24 (42%)
C2H2 Zn finger 247..267 CDD:275368 9/21 (43%)
C2H2 Zn finger 275..296 CDD:275368 3/6 (50%)
C2H2 Zn finger 304..324 CDD:275368
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.