DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14710 and Zfp369

DIOPT Version :9

Sequence 1:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_848141.3 Gene:Zfp369 / 170936 MGIID:2176229 Length:845 Species:Mus musculus


Alignment Length:363 Identity:93/363 - (25%)
Similarity:150/363 - (41%) Gaps:63/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 MCLNSQVYWETSSSE----RPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDEQQE 133
            :.:.::.|.|.:.||    |..:.|.|:||...::.......|.|..|....:.::.:  :.|..
Mouse   511 LAVPAEFYQEATGSEEGRFRNSSNAMAADAPPKIHQKGPEWHKAGKSNNSMLQGSSAQ--NHQMG 573

  Fly   134 DQSQEVLDFNGFIINESIEED--EEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVEELSNA 196
            .::....| |..:.:..|.:.  :|...:.....|     .:|...|.    ..|.|.:.|||..
Mouse   574 SRAGRARD-NSILTHVKIHQKGYKEGKIQGNNNYL-----KHVKPHQK----GSKEERLRELSTC 628

  Fly   197 NTFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELK--------FKRKDINAKERGNQ 253
            ..  .|.|..:.|..|..              |:.||.:|.:|        ::..|:....|.| 
Mouse   629 QK--HVPYVKQHLKTSGR--------------GKGRKINASIKCGPYIKTYYRGSDVGRLRRAN- 676

  Fly   254 PKCK-------EEEKFM----------CILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQ 301
             .|:       ::..|:          |..||.:|.....|:.|...|:..:|:.|..|.|:|.|
Mouse   677 -NCRKAISRHAQQISFIKIHKGSQICQCSECGKMFRNARYFSVHKKIHTGERPYMCMSCGKAFVQ 740

  Fly   302 MGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHIL 366
            ...|..|:|.|:|:||::|..|.|.|.|||...:|.|.||..:||.||.|||.|..::.|..|:.
Mouse   741 SSSLTQHLRIHSGERPFECSECGRTFSDRSAASQHLRTHTGAKPYQCQHCGKAFRQSSHLTRHVR 805

  Fly   367 SHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRNKMEQ 404
            .|:.::.|.|..|.|:||....|..|.:  |||.|.::
Mouse   806 IHTGERPYVCTKCGKAFTQSSNLIGHQK--THRKKFKK 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 1/9 (11%)
COG5048 <261..395 CDD:227381 51/143 (36%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 10/22 (45%)
C2H2 Zn finger 320..340 CDD:275368 9/19 (47%)
zf-H2C2_2 335..357 CDD:290200 12/21 (57%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
C2H2 Zn finger 376..395 CDD:275368 7/18 (39%)
Zfp369NP_848141.3 KRAB 35..94 CDD:214630
KRAB 35..74 CDD:279668
SCAN 179..266 CDD:280241
KRAB 300..>340 CDD:214630
KRAB 300..339 CDD:279668
C2H2 Zn finger 676..695 CDD:275370 3/20 (15%)
C2H2 Zn finger 703..723 CDD:275368 6/19 (32%)
zf-H2C2_2 715..740 CDD:290200 8/24 (33%)
COG5048 727..>792 CDD:227381 29/64 (45%)
C2H2 Zn finger 731..751 CDD:275368 8/19 (42%)
zf-H2C2_2 743..767 CDD:290200 10/23 (43%)
zf-C2H2 757..779 CDD:278523 9/21 (43%)
C2H2 Zn finger 759..779 CDD:275368 9/19 (47%)
zf-C2H2 785..807 CDD:278523 9/21 (43%)
C2H2 Zn finger 787..807 CDD:275368 8/19 (42%)
zf-H2C2_2 799..824 CDD:290200 8/24 (33%)
C2H2 Zn finger 815..835 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.