DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jupiter and Jpt2

DIOPT Version :9

Sequence 1:NP_731599.1 Gene:Jupiter / 41392 FlyBaseID:FBgn0051363 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_945175.1 Gene:Jpt2 / 52009 MGIID:1196260 Length:190 Species:Mus musculus


Alignment Length:220 Identity:57/220 - (25%)
Similarity:74/220 - (33%) Gaps:73/220 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GKAKKRVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAAEKDNGVKNNVRQGAHRFYFIGDAP 80
            ||:..|.::||||.|||:|||.......:..||||||||                        .|
Mouse    10 GKSGSRSMKPPGGESSDLFGSPEEGISSSKPNRMASNIF------------------------GP 50

  Fly    81 RRGQKTVDSHSRLFGEPTRPITPGKNHMKSSIPFGQNTEAVAAQKLLTTNGHYNGKSGSVSSASS 145
            ....|.:         |.|...||.   |.|..|.::|.....|:|       |...|..|....
Mouse    51 TEEPKNI---------PKRTNPPGG---KGSGIFDESTPVQTRQRL-------NPPGGKTSDIFG 96

  Fly   146 SVSSSTENLKMNSGSRSEGNPVTGEGYK---VVANEYSQRQESSNGG-------------TPVI- 193
            |..::|..|...:..:.......||..|   ..|.:.:.|.|.|:.|             ||.: 
Mouse    97 SPVTATAPLAHPNKPKDHVLLCEGEDSKSDLKAATDSTPRGEQSDKGSSKEVEHAKIPEPTPTVD 161

  Fly   194 -------------NKNRIPPGGYSS 205
                         ||...||||.||
Mouse   162 SHEPRLGPRPRSHNKVLNPPGGKSS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JupiterNP_731599.1 JUPITER 1..208 CDD:293659 57/220 (26%)
Jpt2NP_945175.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..190 57/220 (26%)
JUPITER 10..>104 CDD:293659 38/136 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1620782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34930
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4211
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.980

Return to query results.
Submit another query.