powered by:
Protein Alignment Jupiter and JPT1
DIOPT Version :9
Sequence 1: | NP_731599.1 |
Gene: | Jupiter / 41392 |
FlyBaseID: | FBgn0051363 |
Length: | 208 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002032.1 |
Gene: | JPT1 / 51155 |
HGNCID: | 14569 |
Length: | 181 |
Species: | Homo sapiens |
Alignment Length: | 60 |
Identity: | 25/60 - (41%) |
Similarity: | 33/60 - (55%) |
Gaps: | 2/60 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAAYAAFKHVELYNVGKAKKRVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAAEKDN 60
|.....||.|:..: :...||||||||||:...|.:.|......||:||||||...::|
Human 1 MTTTTTFKGVDPNS--RNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEEN 58
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006826 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR34930 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.970 |
|
Return to query results.
Submit another query.