DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jupiter and RGD1559903

DIOPT Version :9

Sequence 1:NP_731599.1 Gene:Jupiter / 41392 FlyBaseID:FBgn0051363 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001102807.1 Gene:RGD1559903 / 502418 RGDID:1559903 Length:175 Species:Rattus norvegicus


Alignment Length:221 Identity:51/221 - (23%)
Similarity:73/221 - (33%) Gaps:90/221 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GKAKKRVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAAEKDNGVKNNVRQGAHRFYFIGDAP 80
            |:...|.::.|||.||:.|||.....|    .|||||||...::  .||              .|
  Rat    10 GRLGSRSIKLPGGESSNPFGSPSTSKP----YRMASNIFGPPEE--PKN--------------IP 54

  Fly    81 RRGQKTVDSHSRLFGEPT------RPITPGKNHMKSSIPFGQNTEAVAAQKLLTTNGHYNGKSGS 139
            :|........|.:|.|.|      ||..||.   |:|..||                        
  Rat    55 KRTNPPGGKGSGIFDESTPVQTRHRPNPPGG---KTSDIFG------------------------ 92

  Fly   140 VSSASSSVSSSTENLKMNSGSRSEGNPVTGEG-----------YKVVANEYSQRQESSNGGTPVI 193
                    |..|..:.:...::.:.:.:..||           |.....|::::.|:    ||.:
  Rat    93 --------SPVTATMPLAHPNKPKDHVLLCEGEDCKPDWKASTYSAPRREHAKKPEA----TPTV 145

  Fly   194 --------------NKNRIPPGGYSS 205
                          ||...||||.||
  Rat   146 DSHEPRLGPRPRSHNKVLNPPGGKSS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JupiterNP_731599.1 JUPITER 1..208 CDD:293659 51/221 (23%)
RGD1559903NP_001102807.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12063
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1620782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34930
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4211
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.980

Return to query results.
Submit another query.