DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jupiter and Jpt2

DIOPT Version :9

Sequence 1:NP_731599.1 Gene:Jupiter / 41392 FlyBaseID:FBgn0051363 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001013200.1 Gene:Jpt2 / 360492 RGDID:1305117 Length:190 Species:Rattus norvegicus


Alignment Length:210 Identity:55/210 - (26%)
Similarity:82/210 - (39%) Gaps:50/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GKAKK---RVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAAEKDNGVKNNVRQGAHRFYFIG 77
            |:|.|   |.::||||.|:|||||.....|.:..:|||||||...::  .||             
  Rat     7 GQASKSGFRSMKPPGGESNDIFGSPEEGVPSSKPHRMASNIFGPTEE--PKN------------- 56

  Fly    78 DAPRRGQKTVDSHSRLFGEPTRPITPGKNHMKSSIPFGQNTEAVAAQKLLTTN-GHYNGKSGSV- 140
             .|:|........|.:|.|.    ||.:...:.:.|.|:.::...:....|.. .|.|.....| 
  Rat    57 -IPKRTNPPGGKGSGIFDES----TPVQTRQRLNPPGGKTSDIFGSPVTATAPLAHPNKPKDHVL 116

  Fly   141 --------SSASSSVSSSTENLKMNSGSRSEGNPV-------TGEGYKVVANEYSQRQESSNGGT 190
                    |...::.:|:....:...||.:|..|.       |.:.::   .....|..|.|   
  Rat   117 LCEGEDCKSDLKAATNSTPRGEQGEKGSSTEAEPAKIPEPIPTVDSHE---PRLGPRPRSHN--- 175

  Fly   191 PVINKNRIPPGGYSS 205
            .|:|    ||||.||
  Rat   176 KVLN----PPGGKSS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JupiterNP_731599.1 JUPITER 1..208 CDD:293659 55/210 (26%)
Jpt2NP_001013200.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 36/125 (29%)
JUPITER 10..>104 CDD:293659 32/113 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..190 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12063
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1620782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34930
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4211
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.980

Return to query results.
Submit another query.