DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jupiter and Jpt1

DIOPT Version :9

Sequence 1:NP_731599.1 Gene:Jupiter / 41392 FlyBaseID:FBgn0051363 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_032284.1 Gene:Jpt1 / 15374 MGIID:1096361 Length:154 Species:Mus musculus


Alignment Length:221 Identity:52/221 - (23%)
Similarity:73/221 - (33%) Gaps:87/221 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAYAAFKHVELYNVGKAKKRVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAAEKDNGVKNN 65
            |.....||.|:..:  :...||||||||||:...|.:.|......||:||||||...::|     
Mouse     1 MTTTTTFKGVDPNS--RNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEEN----- 58

  Fly    66 VRQGAHRFYFIGDAPRRGQKTVDSHSRLFGEPTRPITPGKNHMKSSIPFGQNTEAVAAQKLLTTN 130
                                              |.:..|:                        
Mouse    59 ----------------------------------PPSWAKS------------------------ 65

  Fly   131 GHYNGKSGSVSSASSSVSSSTENLKMNSGSRSEGN--PVTGEG--YKVVANEY----SQRQESSN 187
                  :||.||.....|.|....:.||...|.|:  .:.|||  ::.|..::    :|.:|...
Mouse    66 ------AGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPV 124

  Fly   188 GGTPV--------INKNRIPPGGYSS 205
            ...||        :...|.||||.||
Mouse   125 PAAPVPSPVAPAPVPSRRNPPGGKSS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JupiterNP_731599.1 JUPITER 1..208 CDD:293659 52/221 (24%)
Jpt1NP_032284.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..154 52/221 (24%)
JUPITER 1..>58 CDD:293659 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006826
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34930
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.060

Return to query results.
Submit another query.