DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jupiter and jpt1

DIOPT Version :9

Sequence 1:NP_731599.1 Gene:Jupiter / 41392 FlyBaseID:FBgn0051363 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001139220.1 Gene:jpt1 / 100271760 XenbaseID:XB-GENE-958068 Length:143 Species:Xenopus tropicalis


Alignment Length:125 Identity:33/125 - (26%)
Similarity:47/125 - (37%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KAKKRVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAAEKDNGVKNNVRQGAHRFYFIGDAPR 81
            ::..|||.||||||:..||....|.....|::||||||....|........|........|:...
 Frog    15 RSSSRVLMPPGGGSNFSFGVGESQAQPVRKHKMASNIFGVVDDEPAPTKQAQETGTPDACGELDS 79

  Fly    82 RGQKTVDS-----------------------HSRLFGEPTRPITPGKNHMKSSIPFGQNT 118
            ..:.|..|                       .|::.|||.:|..|.....:.:.|.|::|
 Frog    80 AAEWTCQSEDCSNASGNMDEMAMPETESGKEQSQVAGEPAQPAQPAAAPSRRNPPGGRST 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JupiterNP_731599.1 JUPITER 1..208 CDD:293659 33/125 (26%)
jpt1NP_001139220.1 JUPITER 15..>57 CDD:293659 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006826
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34930
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.